DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG30082

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:281 Identity:97/281 - (34%)
Similarity:133/281 - (47%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PKCG------PHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCV 184
            |.||      |   :|::..|....|....|:|.|     .....|.|.|:||..|:|||||||:
  Fly    26 PNCGTTINLPP---TNRIVGGRTADIGSNPWLAYL-----HKNSSLVCTGTLITKRFVLTAAHCL 82

  Fly   185 IGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLR 249
                  ...||.||||||||||..:||..:.|.....:..:|.|.:|..:.....:| :||.||:
  Fly    83 ------HSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSR-NDIGLLK 140

  Fly   250 LDRPVVLNEYIQPVCL-------PLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDH 307
            |:..||...:|:|:||       |..||..|         :|||:......:|:.|.::|...|.
  Fly   141 LNGTVVYKLFIRPICLFRDPGQVPYSSTYEA---------AGWGKIDLINTATVLQTVNLIRLDQ 196

  Fly   308 DYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRR---GFDQAWYQEGVVSFGNRCGLE 369
            ..|.|...|   .|...|.| .|::..|:|.|||||||.|:   |......|.|:||:|:.  |.
  Fly   197 SDCERSLRT---SLSYGQFC-AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHY--LC 255

  Fly   370 GWPGVYTRVADYMDWIVETIR 390
            ..|||||.|..:.:||:...|
  Fly   256 RGPGVYTYVPSFTNWILSITR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 89/258 (34%)
Tryp_SPc 137..388 CDD:238113 91/260 (35%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 89/258 (34%)
Tryp_SPc 40..274 CDD:238113 91/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.