DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and TPSD1

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:246 Identity:71/246 - (28%)
Similarity:107/246 - (43%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LLPSP----PKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELS-CGGSLINNRYVLTA 180
            :|.||    |..|.......:..|.:....::.|...|..   ||...:. ||||||:.::||||
Human    18 VLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRV---RGPYWMHFCGGSLIHPQWVLTA 79

  Fly   181 AHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQ----LGIEQATVHPQYDPANKNR 241
            |||    ||.::..|..:|:             .:..|.:..    |.:.:..||||:.......
Human    80 AHC----VEPDIKDLAALRV-------------QLREQHLYYQDQLLPVSRIIVHPQFYIIQTGA 127

  Fly   242 IHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWG----RTTTARKSTIKQRLDL 302
              |||||.|:.||.::.:|..|.||..|.  ....|....|:|||    .........:|: :::
Human   128 --DIALLELEEPVNISSHIHTVTLPPASE--TFPPGMPCWVTGWGDVDNNVHLPPPYPLKE-VEV 187

  Fly   303 PVNDHDYCARKFATRNIH-------LISSQLCVGGEFYRDSCDGDSGGPLM 346
            ||.::..|..::.| .:|       :....||.|.|.: |||.|||||||:
Human   188 PVVENHLCNAEYHT-GLHTGHSFQIVRDDMLCAGSENH-DSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 66/227 (29%)
Tryp_SPc 137..388 CDD:238113 66/226 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 66/226 (29%)
Tryp_SPc 38..240 CDD:214473 66/226 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.