DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and Tmprss11d

DIOPT Version :10

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:30 Identity:10/30 - (33%)
Similarity:15/30 - (50%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NAQGSIPLASLGTTNDPLPGRLPLLSRAPI 89
            |....:|:..|||...| ||::....:|.|
Mouse     8 NTGADMPILGLGTWKSP-PGKVAEAVKAAI 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:463440 8/23 (35%)
Tryp_SPc 137..388 CDD:238113
Tmprss11dNP_663536.1 SEA 48..140 CDD:460188
Tryp_SPc 186..414 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.