DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and F10

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:410 Identity:110/410 - (26%)
Similarity:175/410 - (42%) Gaps:87/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPNQKQGQC---LSIYDCQSLLSVIQQSYVSPEDRTFLRNSQCLDGVG-------RQPYVCCTSD 87
            :|.|.||:|   |..|.|..|     :.:.......|.|....||...       .|..|.|:..
Human    93 SPCQNQGKCKDGLGEYTCTCL-----EGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCA 152

  Fly    88 RSFGSQEATSAAPP------------------PTTTSSSSRGQDG-------QAGLG------NL 121
            |.:...:...|..|                  ...||||....|.       .|.|.      :|
Human   153 RGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDL 217

  Fly   122 L---PSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHC 183
            |   .:.|:.|.::.: ::..|.:....|..|.|||...:|.|    .|||::::..|:||||||
Human   218 LDFNQTQPERGDNNLT-RIVGGQECKDGECPWQALLINEENEG----FCGGTILSEFYILTAAHC 277

  Fly   184 VIGAVETEVGHLTTVRLGEYDTSKDV--DCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIA 246
            :..|...:      ||:|:.:|.::.  :.:.:          :|....|.::  ..:....|||
Human   278 LYQAKRFK------VRVGDRNTEQEEGGEAVHE----------VEVVIKHNRF--TKETYDFDIA 324

  Fly   247 LLRLDRPVVLNEYIQPVCLP----LVSTRMAINTGELLVVSGWGRT-TTARKSTIKQRLDLPVND 306
            :|||..|:.....:.|.|||    ..||.|...||   :|||:||| ...|:||..:.|::|..|
Human   325 VLRLKTPITFRMNVAPACLPERDWAESTLMTQKTG---IVSGFGRTHEKGRQSTRLKMLEVPYVD 386

  Fly   307 HDYCARKFATRNIHLISSQLCVGGEF-YRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEG 370
            .:.|  |.::..| :..:..|.|.:. ..|:|.||||||.:.| |...::..|:||:|..|..:|
Human   387 RNSC--KLSSSFI-ITQNMFCAGYDTKQEDACQGDSGGPHVTR-FKDTYFVTGIVSWGEGCARKG 447

  Fly   371 WPGVYTRVADYMDWIVETIR 390
            ..|:||:|..::.||..:::
Human   448 KYGIYTKVTAFLKWIDRSMK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 15/60 (25%)
Tryp_SPc 136..385 CDD:214473 78/256 (30%)
Tryp_SPc 137..388 CDD:238113 80/258 (31%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 9/33 (27%)
FXa_inhibition 129..164 CDD:317114 6/34 (18%)
O-glycosylated at one site 183..203 5/19 (26%)
Tryp_SPc 235..464 CDD:238113 80/257 (31%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.