DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and C1s

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_620255.2 Gene:C1s / 192262 RGDID:619983 Length:694 Species:Rattus norvegicus


Alignment Length:415 Identity:113/415 - (27%)
Similarity:172/415 - (41%) Gaps:92/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TCLLPFTVLQNVAAQGSCRNPNQKQGQ-------CLSIYDCQSLLSVIQQSYVSPEDRTFLRNSQ 71
            ||:..|.|::......|..:..|..||       |..: ||.....:.......|||..|     
  Rat   326 TCVDGFEVVEGNVGSTSFYSTCQSNGQWSNSRLECQPV-DCGVPEPIENGKVEDPEDTVF----- 384

  Fly    72 CLDGVGRQPYVCCTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPS-PPKCG----PH 131
                 |...:..|.....:..||...      ....::.|......||..||. .|.||    |.
  Rat   385 -----GSVIHYTCEEPYYYMEQEEGG------EYHCAANGSWVNDQLGVELPKCIPVCGVPTEPF 438

  Fly   132 SFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCV---------IGA 187
            ....:::.|..|.|..|.|....|  ..||      ||:||:..:||||||.|         :|:
  Rat   439 KVQQRIFGGYSTKIQSFPWQVYFE--SPRG------GGALIDEYWVLTAAHVVEGNSDPVMYVGS 495

  Fly   188 VETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHP---QYDPAN--KNRIHDIAL 247
            ...::..|...:                      :|..|:..:||   |.|..|  .|..:||||
  Rat   496 TLLKIERLRNAQ----------------------RLITERVIIHPSWKQEDDLNTRTNFDNDIAL 538

  Fly   248 LRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQR-LDLPVNDHDYCA 311
            ::|..||.:...:.|:|||..|:....:.|:|.::||||||.. |.:.|:.| ..||:...:.|.
  Rat   539 VQLKDPVKMGPTVAPICLPETSSDYNPSEGDLGLISGWGRTEN-RTNVIQLRGAKLPITSLEKCQ 602

  Fly   312 R-----KFATRNIHLISSQLCVGGEFYRDSCDGDSGG------PLMRRGFDQAWYQEGVVSFGNR 365
            :     ..|..|.::.:..:...||...|||:|||||      |.::   |..:|..|:||:|.:
  Rat   603 QVKVENPKARSNDYVFTDNMICAGEKGVDSCEGDSGGAFALPVPNVK---DPKFYVAGLVSWGKK 664

  Fly   366 CGLEGWPGVYTRVADYMDWIVETIR 390
            ||..   |:||:|.:|:|||::|::
  Rat   665 CGTY---GIYTKVKNYVDWILKTMQ 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 11/59 (19%)
Tryp_SPc 136..385 CDD:214473 82/274 (30%)
Tryp_SPc 137..388 CDD:238113 84/276 (30%)
C1sNP_620255.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:405372
CUB 181..293 CDD:395345
CCP 300..361 CDD:153056 8/34 (24%)
CCP 365..428 CDD:153056 14/78 (18%)
Tryp_SPc 443..681 CDD:214473 82/274 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.