DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and Tpsb2

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:286 Identity:88/286 - (30%)
Similarity:135/286 - (47%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELS-----CGGSLINNRYV 177
            |.:|:.|.|:  |.:....:..|::.:..::.|...|.:       :|:     ||||||:.::|
Mouse    15 LASLVYSAPR--PANQRVGIVGGHEASESKWPWQVSLRF-------KLNYWIHFCGGSLIHPQWV 70

  Fly   178 LTAAHCVIGAVETEVGHLTTVRLGE----YDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPAN 238
            |||||||...:::.  .|..|:|.|    |.        |.:       |.:.:..|||.|..|.
Mouse    71 LTAAHCVGPHIKSP--QLFRVQLREQYLYYG--------DQL-------LSLNRIVVHPHYYTAE 118

  Fly   239 KNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTAR----KSTIKQR 299
            ...  |:|||.|:.||.::.::.|:.||..|.  ....|....|:|||......    ...:|| 
Mouse   119 GGA--DVALLELEVPVNVSTHLHPISLPPASE--TFPPGTSCWVTGWGDIDNDEPLPPPYPLKQ- 178

  Fly   300 LDLPVNDHDYCARKFAT-----RNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGV 359
            :.:|:.::..|.||:.|     .:..::...:...|...||||.|||||||:.: ....|.|.||
Mouse   179 VKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCK-VKGTWLQAGV 242

  Fly   360 VSFGNRCGLEGWPGVYTRVADYMDWI 385
            ||:|..|.....||:||||..|:|||
Mouse   243 VSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 81/266 (30%)
Tryp_SPc 137..388 CDD:238113 83/267 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 83/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.