DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG12256

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:120/260 - (46%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KVYNGNDTAIDEF-NWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVR 199
            :|..|.|...||: .:...::::...|:....||||||....||||||||.|...:.:..:..:|
  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIR 110

  Fly   200 LGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVC 264
                          |:.:....:..::...::..|.....:   |||:|::|.|..|:|  :.|.
  Fly   111 --------------DLNDSSGFRSQVQSYEMNENYQELVTS---DIAILKIDPPFELDE--KRVS 156

  Fly   265 LPLVSTRMAINTGELLVVSGWGRT------TTARKSTIKQRLDLPVNDHDYCARKFATRNIHLIS 323
            ...||....:...:.::::|||..      ..|:..|:.|:||.....:..|.....    .|..
  Fly   157 TIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT----QLTD 217

  Fly   324 SQLCVGGEFYRDSCDGDSGGPL-MRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVE 387
            :::|....|.:.:|:||||||| |:.|  :::.|.||||:|........|.|||||:.:..||.|
  Fly   218 TEICALERFGKGACNGDSGGPLVMKSG--ESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280

  Fly   388  387
              Fly   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 69/256 (27%)
Tryp_SPc 137..388 CDD:238113 72/259 (28%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 69/256 (27%)
Tryp_SPc 47..280 CDD:238113 71/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.