DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and Tpsab1

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:306 Identity:97/306 - (31%)
Similarity:132/306 - (43%) Gaps:76/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 AAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGR 162
            |||.|..|.....|  ||...||..|....          ...|||     .||..         
Mouse    18 AAPGPAMTREGIVG--GQEAHGNKWPWQVS----------LRANDT-----YWMHF--------- 56

  Fly   163 RELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQ----L 223
                ||||||:.::|||||||    |..:|.....||:             .:..|.:..    :
Mouse    57 ----CGGSLIHPQWVLTAAHC----VGPDVADPNKVRV-------------QLRKQYLYYHDHLM 100

  Fly   224 GIEQATVHPQY----DPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSG 284
            .:.|...||.:    |.|      |||||:|..||.:::|:.||.||..|.  ...:|.|..|:|
Mouse   101 TVSQIITHPDFYIVQDGA------DIALLKLTNPVNISDYVHPVPLPPASE--TFPSGTLCWVTG 157

  Fly   285 WGR----TTTARKSTIKQRLDLPVNDHDYCARKF-----ATRNIHLI-SSQLCVGGEFYRDSCDG 339
            ||.    ........:|: :.:|:.::..|..|:     ...|:|:: ...||.|.|.: |||.|
Mouse   158 WGNIDNGVNLPPPFPLKE-VQVPIIENHLCDLKYHKGLITGDNVHIVRDDMLCAGNEGH-DSCQG 220

  Fly   340 DSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385
            ||||||:.: .:..|.|.||||:|..|.....||:||||..|:|||
Mouse   221 DSGGPLVCK-VEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 84/266 (32%)
Tryp_SPc 137..388 CDD:238113 86/267 (32%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 92/295 (31%)
Tryp_SPc 29..265 CDD:214473 90/293 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.