DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and zgc:163079

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:272 Identity:82/272 - (30%)
Similarity:123/272 - (45%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAA--HCVIGAVET 190
            ||....:.|:..|.:.....:.|.|   .::.:...|..|||||||..:|||.|  ..::.|.:.
Zfish    27 CGRAPLNTKIIGGLNATQGSWPWQA---SINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDI 88

  Fly   191 EV--GHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRP 253
            .|  |..|......|:.|:.|..|                ..||.|:..:.|    :|||:|..|
Zfish    89 VVYLGRQTQNGSNPYEISRTVTKI----------------IKHPNYNSLDSN----LALLKLSSP 133

  Fly   254 VVLNEYIQPVCLPLVSTRMAINTGELLVVSGWG---RTTTARK---STIKQRLDLPVNDHDYCAR 312
            |..::||:||||....:.....|...  |:|||   |..|..:   ..:.|.::.|:.::..|..
Zfish   134 VTFSDYIKPVCLAAAGSVFVDGTASW--VTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNA 196

  Fly   313 KFATRNIHLISSQLCVGGEFYRDS---CDGDSGGPL-MRRGFDQAWYQEGVVSFGNRCGLEGWPG 373
            .:.    .:|:::|...|....|.   |.||.|||| :::|  ..|.|.|||..| .|||.|:|.
Zfish   197 AYG----GIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQG--AIWIQSGVVVSG-YCGLPGYPT 254

  Fly   374 VYTRVADYMDWI 385
            :|.||::|.|||
Zfish   255 IYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 78/262 (30%)
Tryp_SPc 137..388 CDD:238113 79/263 (30%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 78/262 (30%)
Tryp_SPc 36..267 CDD:238113 79/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.