DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and LOC100004427

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:266 Identity:75/266 - (28%)
Similarity:117/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCV----IGAV 188
            ||....:.|:..|.:.....:.|.|.:.:   :...:..|.||||:.|:|||||.|.    :..|
Zfish    27 CGRAPLNTKIVGGLNATEGSWPWQASINF---KSTGQFFCSGSLISERWVLTAASCFQRINVSDV 88

  Fly   189 ETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRP 253
            ...:|.|||.....|:..:.|           :|:.:.:                ||||::|...
Zfish    89 VIYLGRLTTNGSNPYEIPRTV-----------IQVSVTE----------------DIALVQLSSS 126

  Fly   254 VVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRT--TTARKSTIKQRLDLPVNDHDYCARKFAT 316
            |...:||:||||....:.....|...  |:|||.|  |....|.:.:.::.|:.::..|:.   .
Zfish   127 VTFTDYIRPVCLAAAGSVFVDGTESW--VTGWGSTSSTNVILSDMLKEVEAPIVNNIECSN---I 186

  Fly   317 RNIHLISSQLCVG--GEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVA 379
            ..|..:.:.:|.|  .|..:..|..|.|.||:.|...| |.|.|||.| ..||..|:|.:|.||:
Zfish   187 NGITNLDNVICAGFVNETGKAPCWEDFGSPLVTRQGSQ-WIQSGVVVF-TFCGQNGFPTLYARVS 249

  Fly   380 DYMDWI 385
            :|.:||
Zfish   250 EYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 71/256 (28%)
Tryp_SPc 137..388 CDD:238113 72/257 (28%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 71/256 (28%)
Tryp_SPc 36..257 CDD:238113 72/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.