DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and slc25a39

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_012827167.1 Gene:slc25a39 / 496786 XenbaseID:XB-GENE-969813 Length:412 Species:Xenopus tropicalis


Alignment Length:366 Identity:156/366 - (42%)
Similarity:220/366 - (60%) Gaps:46/366 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHK-------------------CFFYSN 133
            |.||||::::.|||::|:.|:|||||:|.|:|:|:.|..|                   ||.|.|
 Frog    69 ITPLQQILASGTGALLTSLFVTPLDVVKIRLQAQRKPLSKVLSVKPLPWALPMRHPKWRCFLYCN 133

  Fly   134 GLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVA 198
            |||||||......:.....|....|:.:.||.:||:|||||.:|||||.||||.|:|:|||||..
 Frog   134 GLMDHLFVCQHATACSTWYRAPTYFNGTLDAFVKITRHEGLTSLWSGLPPTLVMAVPATIIYFTC 198

  Fly   199 YEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQ 263
            |:|.  |....|...|:.|.                 :|:::|..||:.||||:||:||:|||||
 Frog   199 YDQL--RDFLCYGLGYHGSH-----------------IPLIAGALARLGAVTVISPLELIRTKMQ 244

  Fly   264 AQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH---GSQPSF 325
            :::.:|.::...:||.|:..|...||:|..||:|||||||.:||..||.:|:.:.:   ..:..|
 Frog   245 SRQLSYMELGVCLRSAVSQDGWLSLWKGWGPTVLRDVPFSALYWFNYELVKKKMSNTKAAVESPF 309

  Fly   326 SLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVR 390
            .:||.||.::|.|||::|.|||||||..|||.|...:   .|:|. .:.||:..:..|....|.|
 Frog   310 LVSFSAGAVSGAVAAVLTLPFDVVKTQRQIELGNLEL---GPSRK-QRSSTWGAMRRIRAESGTR 370

  Fly   391 GLFAGCGPRLLKVAPACAIMISTFEYSKSFFFHYN-VRHHN 430
            |||||..||::|||||||||||::|:.|:||...| ::..|
 Frog   371 GLFAGFLPRVIKVAPACAIMISSYEFGKNFFQQQNKIKQQN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 62/137 (45%)
Mito_carr 230..321 CDD:278578 39/93 (42%)
Mito_carr 321..425 CDD:278578 50/103 (49%)
slc25a39XP_012827167.1 Mito_carr 69..206 CDD:278578 62/138 (45%)
Mito_carr 219..300 CDD:278578 38/80 (48%)
Mito_carr <326..401 CDD:278578 39/78 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5057
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2686
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1007936at2759
OrthoFinder 1 1.000 - - FOG0001594
OrthoInspector 1 1.000 - - mtm9516
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2199
SonicParanoid 1 1.000 - - X1001
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.