DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and Dic1

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:213 Identity:54/213 - (25%)
Similarity:94/213 - (44%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGI 305
            |..|.:.|..|..|::|::..:|.| |.:..:.|.:..:...|||...:.||..::||.:.:|..
  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQ-QGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTA 76

  Fly   306 YWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARD 370
            .:.:||:.|:   :.:..||.........:|.|..||.||.|:|....|.:    |.......|:
  Fly    77 RFGVYEAGKK---YVNTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQND----VKLPPQQRRN 134

  Fly   371 FGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIM-----ISTFEYSKSF-----FFHYN 425
            :  .:.|..|..:||..|.:.||:|.     ..|.|..|:     |:.::.:|.:     :|..|
  Fly   135 Y--NNAFDGLVRVYRQEGFKRLFSGA-----TAATARGILMTIGQIAFYDQTKIYLLATPYFQDN 192

  Fly   426 VRHHNEALLLDNPKDTTV 443
            :..|..|.|:.....||:
  Fly   193 LVTHFTASLVAGTIATTL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578
Mito_carr 230..321 CDD:278578 21/79 (27%)
Mito_carr 321..425 CDD:278578 27/113 (24%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 21/82 (26%)
PTZ00169 13..273 CDD:240302 54/213 (25%)
Mito_carr 89..184 CDD:278578 26/105 (25%)
Mito_carr 189..278 CDD:278578 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.