DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and Tpc1

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:349 Identity:95/349 - (27%)
Similarity:148/349 - (42%) Gaps:62/349 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQR 155
            |.|:::....|.||.....||||:|.|.|.|..|..|          :....||..  |.|    
  Fly    29 LHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGK----------NAAKEGPGA--LTS---- 77

  Fly   156 PQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEP 220
             :::|...|:..|.|.||:.|.|.|..|..|.::...|..|..|||     |.:.....:...:.
  Fly    78 -KYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQ-----LSLMAKQTSYLADH 136

  Fly   221 RHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ--RQTYAQMLQFVRSVVALQ 283
            :||.            ..:.|..|...||.:.:|::::||::.||  .:.|....:.|.::|..:
  Fly   137 QHLS------------NFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQE 189

  Fly   284 GVWGLWRGLRPTILRDVPFSGIYWPIYESLKQ------NLGHGSQ-PSFSLSFLAGVMAGTVAAI 341
            |..|::|||...:|:..|..|..:..|.....      .:...|| |:::|..| |..:|.::..
  Fly   190 GPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGL-GASSGMLSKT 253

  Fly   342 VTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFS--------RLTGIYRTHGVRGLFAGCGP 398
            :..|||::|...||:..|      |..:.||:  |..        |||  .|..|||||:.|..|
  Fly   254 IVYPFDLIKKRLQIQGFE------SNRQTFGQ--TLQCHGVWDCLRLT--VRQEGVRGLYKGVAP 308

  Fly   399 RLLKVAPACAIMISTFEYSKSFFF 422
            .|||.:...|:..|.::..|...|
  Fly   309 TLLKSSMTTALYFSIYDKLKQVRF 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 35/115 (30%)
Mito_carr 230..321 CDD:278578 21/98 (21%)
Mito_carr 321..425 CDD:278578 36/111 (32%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 35/115 (30%)
PTZ00169 33..329 CDD:240302 91/340 (27%)
Mito_carr 153..222 CDD:278578 18/68 (26%)
Mito_carr 233..328 CDD:278578 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.