DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and SCaMC

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:349 Identity:87/349 - (24%)
Similarity:140/349 - (40%) Gaps:89/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VISACTGAMITACFMTPLDVIKT--RMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRP 156
            |.....||:...| ..|||.||.  ::|:|:....:|                            
  Fly   290 VAGGIAGAVSRTC-TAPLDRIKVYLQVQTQRMGISEC---------------------------- 325

  Fly   157 QFSSSWDALMKISRHE-GLAALWSGLGPTLVSALPSTIIYFVAYEQFK--------ARYLQIYES 212
                     |.|..:| |..::|.|.|..::...|.|...|.||||.|        :|.:.|.|.
  Fly   326 ---------MHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVER 381

  Fly   213 HYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQT--YAQMLQF 275
            .|                         :|..|...:.|::.|:|:::|:: |.|:|  ||.:...
  Fly   382 FY-------------------------AGAAAGGISQTIIYPMEVLKTRL-ALRRTGQYAGIADA 420

  Fly   276 VRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQ----NLGHGSQPSFSLSFLAGVMAG 336
            ...:...:||...:||..|.||..:|::||...:||:||:    |..:..||||.:....|..:.
  Fly   421 AVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSS 485

  Fly   337 TVAAIVTTPFDVVKTHEQIEFGERVI----FTDSPARDFGKKSTFSRLTGIY----RTHGVRGLF 393
            |:..:.:.|..:|:|..|.:..|.:.    .|..|.:.....|....:||::    |..|:.||:
  Fly   486 TLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLY 550

  Fly   394 AGCGPRLLKVAPACAIMISTFEYS 417
            .|..|..|||.||.:|....:||:
  Fly   551 RGITPNFLKVLPAVSISYVVYEYT 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 28/123 (23%)
Mito_carr 230..321 CDD:278578 26/96 (27%)
Mito_carr 321..425 CDD:278578 30/105 (29%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 27/117 (23%)
Mito_carr 375..463 CDD:278578 28/113 (25%)
Mito_carr 470..581 CDD:278578 30/105 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.