DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG7514

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:320 Identity:77/320 - (24%)
Similarity:125/320 - (39%) Gaps:73/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFS 159
            |:.....|:..|.:.|||::|||||                     .|...|          ::.
  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQ---------------------ISATTG----------EYK 50

  Fly   160 SSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLE 224
            ||:|.|:|:.::||:.||::||.    :.|.....|..|...|....:..|...:|         
  Fly    51 SSFDCLLKVFKNEGILALYNGLS----AGLMRQATYTTARMGFYQMEIDAYRKQFN--------- 102

  Fly   225 IRDTKKSLPSVVPMMS-GVTARICAVTVVSPIELVRTKMQ-------AQRQTYAQMLQ-FVRSVV 280
                  :.|:|:..|. |:.|........:|.|:...:|.       |:|:.|..:|. ||| :|
  Fly   103 ------APPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVR-IV 160

  Fly   281 ALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTP 345
            ..:||..||:|..||:.|.:..:.:....|..||........ ..||...|.:|:|.:..|.:.|
  Fly   161 KDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFS-GLSLHIAAAMMSGLLTTIASMP 224

  Fly   346 FDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAP 405
            .|:.||..|.:            :....|.|...|..:.:..|:..|:.|..|.|.::.|
  Fly   225 LDMAKTRIQQQ------------KTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 28/111 (25%)
Mito_carr 230..321 CDD:278578 27/99 (27%)
Mito_carr 321..425 CDD:278578 20/85 (24%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 77/320 (24%)
Mito_carr 19..90 CDD:278578 26/105 (25%)
Mito_carr 104..201 CDD:278578 27/97 (28%)
Mito_carr 207..284 CDD:278578 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.