DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and Tpc2

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:135/362 - (37%) Gaps:93/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LQQVISACTGAMITACFMTPLDVIKTRMQSQQSPA--HKCFFYSNGLMDHLFASGPNGSELASLR 153
            |.|.:........|.....||||:|.|.|.|..|.  ||...| .|:: |.|.|           
  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKY-RGVI-HAFKS----------- 61

  Fly   154 QRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQ 218
                          :...||:..::.|.....|.::...::.|.:|||.::...|.         
  Fly    62 --------------VYAEEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQF--------- 103

  Fly   219 EPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQA----QRQTYAQMLQFVRSV 279
                    |..:..|.::..:.|..|.........|.::|||:|.|    .|::.......:|.|
  Fly   104 --------DYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMVAADPSSRRSQMNTFTGLRKV 160

  Fly   280 VALQGVWGLWRGLRPTILRDVPFSGIYWPIYESL------------KQNLGHGSQPSFSLSFLAG 332
            ..::|..||.|||..|:::..|..|..:..|:.|            :|.: ||     :..||.|
  Fly   161 YKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEI-HG-----AFLFLNG 219

  Fly   333 VMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSR----------LTGIYRTH 387
            .::|.:|.::..|.|::|...|:     :.|..       ::.||.|          :|..:|..
  Fly   220 ALSGVLAKMIVYPADLLKKRIQL-----MAFKQ-------ERKTFGRNPECPTILGCITTTFREE 272

  Fly   388 GVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFFFHY 424
            |:.|.:.|..|.|||.....|:..|.::..|.   ||
  Fly   273 GIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKR---HY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 27/117 (23%)
Mito_carr 230..321 CDD:278578 25/106 (24%)
Mito_carr 321..425 CDD:278578 27/114 (24%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 77/342 (23%)
Mito_carr 23..99 CDD:278578 25/102 (25%)
Mito_carr 108..194 CDD:278578 22/85 (26%)
Mito_carr 216..307 CDD:278578 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.