DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and sea

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:342 Identity:81/342 - (23%)
Similarity:135/342 - (39%) Gaps:76/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQF 158
            |....||. |..|...|.:.:||::|..:..|.|.:   ||:                       
  Fly    38 VAGGITGG-IEICITYPTEYVKTQLQLDEKGAAKKY---NGI----------------------- 75

  Fly   159 SSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHL 223
               :|.:.|.....|...|:.||...:..::|.:...|.|:|..|:..:                
  Fly    76 ---FDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAV---------------- 121

  Fly   224 EIRDTKKSLPSVVPMMSGVTARIC-AVTVVSPIELVRTK-MQAQRQTYAQMLQF---VRSVVALQ 283
               |::..|.:...::.|:.|.:| |:..|:|:|.::.| :..||....:...|   |..::..:
  Fly   122 ---DSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSE 183

  Fly   284 GVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLA----GVMAGTVAAIVTT 344
            |:.|:::||.||||:......|.:.:.|||| :|..|...:..:..|.    |.:||..:....|
  Fly   184 GISGIYKGLTPTILKQGSNQAIRFFVLESLK-DLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNT 247

  Fly   345 PFDVVKTHEQ-IEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACA 408
            |.|||||..| :|..:             .|:|......|.:..|....:.|..|||.:|   |.
  Fly   248 PLDVVKTRMQGLEASK-------------YKNTAHCAVEILKNEGPAAFYKGTVPRLGRV---CL 296

  Fly   409 IMISTFEYSKSFFFHYN 425
            .:..||....||...:|
  Fly   297 DVAITFMIYDSFMDLFN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 24/112 (21%)
Mito_carr 230..321 CDD:278578 27/95 (28%)
Mito_carr 321..425 CDD:278578 27/108 (25%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 76/329 (23%)
Mito_carr 34..117 CDD:278578 23/108 (21%)
Mito_carr 125..220 CDD:278578 27/95 (28%)
Mito_carr 235..314 CDD:278578 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.