DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and Mpcp1

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:331 Identity:66/331 - (19%)
Similarity:117/331 - (35%) Gaps:88/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKI 168
            |...:.|||::|.|:  |..||                               ::.|.:......
  Fly    89 THTMVVPLDLVKCRL--QVDPA-------------------------------KYKSVFTGFRIS 120

  Fly   169 SRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLP 233
            ...||:..|..|..||.:......:..|..||.||..|....      .:|...|        ..
  Fly   121 LAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGD
AI------GEENAFL--------YR 171

  Fly   234 SVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILR 298
            :.:.:.:..:|...|...::|:|..:.|:|........:.:.:..:.|.:||...::||.|..:|
  Fly   172 TGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMR 236

  Fly   299 DVPFSGIYWPIYESL------------KQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKT 351
            .:|::.:.:..:|..            :.:...|.|  ..::|.||.:||...|||:.|.|.|.:
  Fly   237 QIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQ--LVVTFAAGYIAGVFCAIVSHPADTVVS 299

  Fly   352 HEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEY 416
            ......|       :.|.|..|:..:|            ||:.|..||:        :||.|...
  Fly   300 KLNQAKG-------ASALDVAKQLGWS------------GLWGGLVPRI--------VMIGTLTA 337

  Fly   417 SKSFFF 422
            ::.|.:
  Fly   338 AQWFIY 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 21/102 (21%)
Mito_carr 230..321 CDD:278578 15/102 (15%)
Mito_carr 321..425 CDD:278578 26/102 (25%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 22/103 (21%)
Mito_carr <188..258 CDD:278578 13/69 (19%)
Mito_carr 273..350 CDD:278578 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.