DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG18327

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:348 Identity:91/348 - (26%)
Similarity:142/348 - (40%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 AMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQ-FSSSWDA 164
            ||....|..|::|||||:|.|                         .|||:.....| :.|.:.|
  Fly    13 AMGAGVFTNPVEVIKTRIQLQ-------------------------GELAARGSHAQPYKSVFQA 52

  Fly   165 LMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYES-------HYNKSQEPRH 222
            .:.:::::|:..|..||.|.|       ...|| ...|:   |.||..       |.||.     
  Fly    53 FVTVAKNDGILGLQKGLAPAL-------CFQFV-INSFR---LSIYTHAVEKGWVHNNKG----- 101

  Fly   223 LEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---------RQTYAQMLQFVRS 278
             ||...|......   :.||....||    ||..|::|::|||         :..:|.|...:|.
  Fly   102 -EISFAKGMFWGA---LGGVVGSYCA----SPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRK 158

  Fly   279 VVALQGVWGLWRGLRPTILRDVPFSGIYWPIY---ESLKQNLGHGSQPSFSLSFLAGVMAGTVAA 340
            :....||:|||||....:.|....|.:...::   :||.:..|..:.|:. |||.:|:.||:..:
  Fly   159 IYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKENGVVTHPTI-LSFCSGLAAGSFVS 222

  Fly   341 IVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAP 405
            :..||.|||.|.   .:.:.|   |:..|....:.....:..|.|:.||.||:.|..|..|:.||
  Fly   223 LAITPLDVVTTR---LYNQGV---DAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAP 281

  Fly   406 ACAIMISTFE----YSKSFFFHY 424
            ...:::..|:    ..:.:..||
  Fly   282 YSTLVLLFFDELIALREKYDLHY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 26/106 (25%)
Mito_carr 230..321 CDD:278578 26/102 (25%)
Mito_carr 321..425 CDD:278578 30/108 (28%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 27/109 (25%)
PTZ00169 5..293 CDD:240302 89/335 (27%)
Mito_carr 101..201 CDD:278578 28/112 (25%)
Mito_carr 204..296 CDD:278578 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.