DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG8323

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:332 Identity:79/332 - (23%)
Similarity:140/332 - (42%) Gaps:69/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 AMITACFMT-PLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSW-- 162
            |.:.|.|.| |::|||||:|.|                         .|||:   |..:...:  
  Fly    12 ASVGATFFTNPIEVIKTRIQLQ-------------------------GELAA---RGTYVEPYKG 48

  Fly   163 --DALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEI 225
              :|.:.:::::|:..|..||.|.|             |.||.....::  |.|:::.|.|.:..
  Fly    49 IVNAFITVAKNDGITGLQKGLAPAL-------------YFQFIINSFRL--SIYSEAMERRWMHN 98

  Fly   226 RDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---------RQTYAQMLQFVRSVVA 281
            |  |..:...:.::.|....:......||..|::|::|:|         :..:..|...:|.:.:
  Fly    99 R--KGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYS 161

  Fly   282 LQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH---GSQPSFSLSFLAGVMAGTVAAIVT 343
            ..||.|||||....:.|....||.....:...|..|..   .:||:.: ||.||::||::.::..
  Fly   162 RNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQYDLVTQPTLN-SFSAGLIAGSIMSVAI 225

  Fly   344 TPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACA 408
            ||.||:.|.   .:.:.|   |:..|....:........|.|:.||.|::.|.....|::||...
  Fly   226 TPPDVITTR---LYNQGV---DAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHST 284

  Fly   409 IMISTFE 415
            :::..|:
  Fly   285 LVLLFFD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 26/110 (24%)
Mito_carr 230..321 CDD:278578 21/102 (21%)
Mito_carr 321..425 CDD:278578 26/95 (27%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/117 (23%)
PTZ00169 5..293 CDD:240302 79/332 (24%)
Mito_carr 101..200 CDD:278578 21/98 (21%)
Mito_carr 206..301 CDD:278578 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.