DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG8026

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:367 Identity:83/367 - (22%)
Similarity:140/367 - (38%) Gaps:85/367 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRP 156
            :.:::..:|.:::...:.|||:||.|                      ||  .|....|::   |
  Fly    24 EHLVAGVSGGVVSTLILHPLDLIKIR----------------------FA--VNDGRTATV---P 61

  Fly   157 QFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPR 221
            |:.....|...|.|.||...|:.|:.|.:..:..|..:||:.|...|.                 
  Fly    62 QYRGLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKT----------------- 109

  Fly   222 HLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKM-----QAQRQTYAQMLQFVRSVVA 281
            .::..:|...|...:.|::...:.|..:.:.:||.:|:|::     .|....|..|:..:..:..
  Fly   110 FIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYK 174

  Fly   282 LQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFS--------LSFLAGVMAGTV 338
            .:|:.||:||..|.:| .|....|.:..||.||.......:....        |:|.|  ::..:
  Fly   175 EEGIRGLYRGFVPGML-GVSHGAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAA--VSKLI 236

  Fly   339 AAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKV 403
            ||..|.|:.||:...|          |...|..|   |:..:...:|..|.||.:.|....|.:|
  Fly   237 AAAATYPYQVVRARLQ----------DHHHRYNG---TWDCIKQTWRFEGYRGFYKGLKASLTRV 288

  Fly   404 APACAIMISTFEYSKSFFFHYNVRHHNEALLLDNPKDTTVED 445
            .|||.:         :|..:.||.|.   ||....:..|.||
  Fly   289 VPACMV---------TFLVYENVSHF---LLARRKRIETKED 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 26/114 (23%)
Mito_carr 230..321 CDD:278578 23/95 (24%)
Mito_carr 321..425 CDD:278578 25/111 (23%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 70/322 (22%)
Mito_carr 23..115 CDD:278578 26/134 (19%)
Mito_carr 119..213 CDD:278578 23/94 (24%)
Mito_carr 220..307 CDD:278578 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.