DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and colt

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:365 Identity:81/365 - (22%)
Similarity:146/365 - (40%) Gaps:83/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TDSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGL 135
            |::.|:.||        ..|::..::...|.:.......|||.||.|:|:...||          
  Fly     4 TENVSTERK--------ANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPA---------- 50

  Fly   136 MDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYE 200
                    |.        ::|.:..::|...|..::||:..|:.|:...|....|...:.|..|.
  Fly    51 --------PG--------EQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYA 99

  Fly   201 QFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ 265
            ..| |..|..|               |.|.:.|.:  .::|..:.:.:..:::|.|.::..:|.|
  Fly   100 LGK-RLQQRGE---------------DAKLTYPQI--FVAGSFSGLFSTLIMAPGERIKVLLQTQ 146

  Fly   266 R-----QTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLK---QNLGHGSQ 322
            :     :.|..|:.....:....|:..:::|...|:|||:|.:|:|:.:||:|:   ::.....|
  Fly   147 QGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETGQ 211

  Fly   323 PSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQ------IEFGERVIFTDSPARDFGKKSTFSRLT 381
            .|.:.:..||.:||....|:..|.||:|:..|      .:.|.|.:|.|...:|           
  Fly   212 ISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKD----------- 265

  Fly   382 GIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFF 421
                  |...|:.|..|.:|:..||.|......|.:..||
  Fly   266 ------GPLALYRGVTPIMLRAFPANAACFFGIELANKFF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 25/120 (21%)
Mito_carr 230..321 CDD:278578 20/98 (20%)
Mito_carr 321..425 CDD:278578 28/107 (26%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 26/129 (20%)
Mito_carr 112..202 CDD:395101 21/91 (23%)
Mito_carr 210..299 CDD:395101 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.