DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and sesB

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:272 Identity:55/272 - (20%)
Similarity:110/272 - (40%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNK-SQEP 220
            |:....|..::|.:.:|.::.|.|....::...|:..:.|.    ||.:|.|::....:| :|..
  Fly    65 QYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFA----FKDKYKQVFLGGVDKNTQFW 125

  Fly   221 RHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQA------QRQTYAQMLQFVRSV 279
            |:.           ...:.||..|...::..|.|::..||::.|      ||: :..:...:..:
  Fly   126 RYF-----------AGNLASGGAAGATSLCFVYPLDFARTRLAADTGKGGQRE-FTGLGNCLTKI 178

  Fly   280 VALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTT 344
            ....|:.||:||...::...:.:...|:..|::.:..|.........:|:....:..|||.||:.
  Fly   179 FKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSY 243

  Fly   345 PFDVVKTHEQIEFGER---VIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPA 406
            |||.|:....::.|.:   ||:          |:|......|.:..|....|.|....:|:....
  Fly   244 PFDTVRRRMMMQSGRKATEVIY----------KNTLHCWATIAKQEGTGAFFKGAFSNILRGTGG 298

  Fly   407 CAIMISTFEYSK 418
            ..:::...|..|
  Fly   299 AFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 10/49 (20%)
Mito_carr 230..321 CDD:278578 18/96 (19%)
Mito_carr 321..425 CDD:278578 22/101 (22%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 12/54 (22%)
PTZ00169 23..312 CDD:240302 55/272 (20%)
Mito_carr 124..220 CDD:278578 19/107 (18%)
Mito_carr 223..312 CDD:278578 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.