DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg1 and CG30095

DIOPT Version :10

Sequence 1:NP_731172.2 Gene:Nlg1 / 40913 FlyBaseID:FBgn0051146 Length:1354 Species:Drosophila melanogaster
Sequence 2:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster


Alignment Length:58 Identity:16/58 - (27%)
Similarity:21/58 - (36%) Gaps:23/58 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RTRLCPSGNCQGG--STTESKPCVLYDPQPTQPQWGAWGGWSSCSATCGGGTMTRSRV 114
            |:||....:..||  ||.||      ||.               .|..|||.:|..::
  Fly   756 RSRLSSDEDNSGGAPSTAES------DPN---------------GAESGGGQLTTPQI 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg1NP_731172.2 COesterase 157..710 CDD:395084
CG30095NP_725529.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.