DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg3 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:104 Identity:34/104 - (32%)
Similarity:47/104 - (45%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 SPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVTINYRLGVLGFLNANT--DRYSKLPAN 374
            ||.  ||:|||:|.:  |.||:.....:||             |.:...|||:.  ..||..|..
Zfish   116 SPV--PVVVFVYGGA--WGSGDRSIYCLLA-------------LQMAKELNASVICPDYSIYPKG 163

  Fly   375 YGL---MDIIAALHWLKENIAAFGGDPNSITLAGHGTGA 410
            ..|   .||..:|.|:::...||..|.::|.|.||..||
Zfish   164 NVLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAGA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 34/104 (33%)
Aes <313..>410 CDD:223730 31/101 (31%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 34/104 (33%)
Abhydrolase 121..>210 CDD:304388 30/97 (31%)
Abhydrolase 167..336 CDD:304388 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.