DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg3 and CG4382

DIOPT Version :9

Sequence 1:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster


Alignment Length:729 Identity:177/729 - (24%)
Similarity:271/729 - (37%) Gaps:227/729 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SGSNSNR--------SSRPTSNNSNSNSNYSPNHDQLPAQLSSRIINTRNGAISGVIV-QLDGRH 176
            ||.||:.        ...|..:|.               :||..:|.|..|.|.|.|: ...||:
  Fly    16 SGQNSDEDLSKAIPDEEDPIGSNK---------------ELSDLVITTALGKIRGTILPSQSGRN 65

  Fly   177 LDPVEAYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSPVCPQRLPDIHNETAALERMPKGR 241
            .   .|:||||||.|||..|||.||.....|.....|....|.||| |..:..:.          
  Fly    66 F---YAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDATFDGPKCPQ-LGLVSGDV---------- 116

  Fly   242 LEYLKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSSSSSSSSSTSSS 306
                          |||||.:|||                                     |...
  Fly   117 --------------SEDCLRVNIY-------------------------------------TKEL 130

  Fly   307 SAGSGSPAKYPVLVFVHGESYEWNSGNP--YDGSVLASYGQILVVTINYRLGVLGFLNANTDRYS 369
            .:.|....:.||:||:|...:...||..  :.|.......::::||.|||||.||||...|   .
  Fly   131 PSESQPNVRRPVIVFIHPGGFYSLSGQSKNFAGPQYFMNRRLVLVTFNYRLGSLGFLATGT---R 192

  Fly   370 KLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHF-LISSMAVPEGLLFNRAIL 433
            :.|.|.||.|.:..|.|:|.:|:.|||||:||||.|:|.||..|.. ::|.|:  .| ||::||:
  Fly   193 EAPGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAMAVTLHMVSPMS--RG-LFHKAIV 254

  Fly   434 MSGSGLAPWSLVSNPAKYAAIVAHHVNCASDLPHAHLMKCLREK-------TLDQ---------- 481
            |||:....|||..:....|...|..::|.:: ....:|.||:.|       ||.:          
  Fly   255 MSGAVTGQWSLPDHQMDVATKQATLLHCHTE-NVTEMMDCLKGKHYLEFANTLPKMFEFDRNNPL 318

  Fly   482 LLSVPIRPPEFG-----------------FAFGPSIDGVVIDGGDYVPPAPGSPAAQAQAQASTA 529
            :|..|:..|:||                 |...|.|.|:..|  ::|.||..             
  Fly   319 ILWKPVIEPDFGQERFLVEEPIRSYQNDDFMKVPIITGMTKD--EFVGPALS------------- 368

  Fly   530 AGNGLGGEAGIAAAGGWGTPGQLENIVLMRKTAINKLS-RYDLMAGVTRAEAFFSFNSGDVQYGI 593
                                      :|...|.::.|: .::.:|.|     ||.:|:       
  Fly   369 --------------------------ILQSPTLLSALNENFESLAPV-----FFMYNT------- 395

  Fly   594 EADRRSRILKAYVRNTYTFHLNEIFATIVNEYTDWERPVQHPINIRDETLEALSDAQVVAPAAQT 658
             :|.|:..:...:||.|          ..::..|..|.::...|:..:.|......:.|..||::
  Fly   396 -SDARACNISQELRNHY----------FPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLAARS 449

  Fly   659 VDLHSADHRNSYLYVFDYQTRFGD--YPQ--RQGCIHGEDLPYIFGAPLVGGFNHFTRNYTK--T 717
            ..:        |.|.|.||.....  ||:  ..|.:|.:||.|:|..|.:      :|.:|:  .
  Fly   450 TKV--------YYYRFSYQGARSHIYYPEDAPYGVVHHDDLMYLFVEPSI------SRMFTEDDD 500

  Fly   718 EISLSEVVMFYWSNFVRTGNPNEQMETEHGSRQERSRYKTIEWTAYESVHKKYLNFDTKPKLKNH 782
            |..:.::::..:|.|...|:||:..:.         ..:.|.|..:....:.||:......|:.:
  Fly   501 EFRMVDIMVRMFSAFAYKGDPNKPTDL---------ALRDIRWRPFSFKKRYYLDIGKHITLEEN 556

  Fly   783 YRAHRLSFWLNLIP 796
            ..|.....|..|.|
  Fly   557 LNAENYEIWKRLFP 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 168/684 (25%)
Aes <313..>410 CDD:223730 40/98 (41%)
CG4382NP_609301.2 COesterase 41..565 CDD:278561 168/682 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.