DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg3 and SPAPB18E9.04c

DIOPT Version :9

Sequence 1:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_001018272.1 Gene:SPAPB18E9.04c / 3361427 PomBaseID:SPAPB18E9.04c Length:800 Species:Schizosaccharomyces pombe


Alignment Length:333 Identity:76/333 - (22%)
Similarity:126/333 - (37%) Gaps:96/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPPSAATRTRRKVPPTRRRSTWALSSLLALVVLDICIARCLAAGISYSSNSGNLS---TSQKSPS 71
            :||::.:.|...:|||...||...|:.|...... |..   :..|..:..|.:||   |....|:
pombe   138 VPPTSTSSTSIPIPPTSTSSTDTNSNPLPTTSTS-CTT---STSIPPTGGSSSLSTPITPTVPPT 198

  Fly    72 SANNGGLVL----IGSSSATSSSVPSLSLTSSSSAGLSSPGSSS------------SSSSSS--- 117
            |.::..:.:    ..|:...||.:|:.|.:.::|..:.:.||||            |:||:|   
pombe   199 STSSTSIPIPPTSTSSTDTNSSPLPTTSTSCTTSTSIPTGGSSSLSTPITPTVPPTSTSSTSIPI 263

  Fly   118 --TSTSGSNSNRSSRPTSNNSNSNSNYSPNHDQLPAQLSSRIINTRNGAISGVIVQLDGRHLDPV 180
              ||||.:::|.|..||::.|.:.|...|........::..:..|...:.|              
pombe   264 PPTSTSSTDTNSSPLPTTSTSCTTSTSIPPTGNSTTPVTPTVPPTSTSSTS-------------- 314

  Fly   181 EAYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSPVCPQRLPDIHNE-TAALERMPKGRLEY 244
                     :||       ||.|.:. :|...    ||     ||..... |.:....|.|    
pombe   315 ---------TPP-------PPASTSS-TGTSS----SP-----LPSTSTSCTTSTSIPPTG---- 349

  Fly   245 LKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSSSS-----SSSSSTS 304
                              |...|:......:|.||:|:....:|:.|.|:|||     |:|.:||
pombe   350 ------------------NSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLLSTSTSCTTS 396

  Fly   305 SSSAGSGS 312
            :|...:|:
pombe   397 TSIPPTGN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 33/168 (20%)
Aes <313..>410 CDD:223730 76/333 (23%)
SPAPB18E9.04cNP_001018272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.