DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg3 and CG30095

DIOPT Version :9

Sequence 1:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster


Alignment Length:104 Identity:19/104 - (18%)
Similarity:38/104 - (36%) Gaps:39/104 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 LHSADHRNSYLYVFDYQTRFGDYPQRQGCIHGEDLPYI---FGA----PLVGGF-----NHFTRN 713
            :.|.:|:.::|::|                   .:|||   :.|    |.|.||     ::..|:
  Fly    55 ISSLEHQRTFLHLF-------------------HVPYIICFYAAKGKWPYVPGFMKYRVDNAARS 100

  Fly   714 YTKTEISLSEVVMFYWSN--------FVRTGNPNEQMET 744
            :.....|..:.....|..        |.::.|.:.::||
  Fly   101 FFNQNDSFIKQFCTKWIQVKECFRPLFDKSNNTDVEVET 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 19/104 (18%)
Aes <313..>410 CDD:223730
CG30095NP_725529.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.