DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg3 and clt

DIOPT Version :9

Sequence 1:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster


Alignment Length:678 Identity:153/678 - (22%)
Similarity:243/678 - (35%) Gaps:208/678 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GVIVQLDGRHLDPVE--AYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSPVCPQRLPDIHN 229
            ||:|....:.::.:|  ::.|:|||.||||.|||..|         :..:||             
  Fly    27 GVLVGRQKKLVNGLEYNSFLGVPYAEPPVGELRFRSP---------RPLERF------------- 69

  Fly   230 ETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGS 294
            :...|:...:|.:.|.:.........|||||:||:|.|....:|                     
  Fly    70 QKQELDCSKEGNVSYQRDPFTLEVAGSEDCLFLNVYAPKVKSTR--------------------- 113

  Fly   295 SSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNP---YDGSVLASYGQILVVTINYRLG 356
                               ...||:|::||..:.:.:||.   :...::..  :::|||:|||||
  Fly   114 -------------------TPLPVMVWIHGGGFFFGNGNSDFHFPAKLMEQ--EVIVVTLNYRLG 157

  Fly   357 VLGFLNANTDRYSKLP-----ANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHFL 416
            .||||:        ||     .|.||.|...||.|::||||:|.||||::||.|...|.:.||  
  Fly   158 ALGFLS--------LPEEGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGSSVH-- 212

  Fly   417 ISSMAVPEGLLFNRAILMSGSGLAPWSLVSN-PAKYAAI---------------VAHHVNCASDL 465
            :.:.|.....||::||:.||:....|...:. |||...:               :...:......
  Fly   213 LHTFARHAKRLFHKAIMQSGTANMEWVFQNEAPAKTRRLAELLGGGDFGGDSKALLTFLQSEKAT 277

  Fly   466 PHAHLMKCLREKTLDQLLSVPIRPPEFGFAFGPSIDGVVIDGGDYVPPAPGSP-----------A 519
            |.|.|...|:      :||...|.....|||.|    ||.|.        .||           .
  Fly   278 PTAILANTLK------VLSPDERRRHLPFAFKP----VVEDS--------SSPDRFLEQDIMELM 324

  Fly   520 AQAQAQASTAAGNGLGGEAGIAAAGGWGTPGQLENIVLMRKTAINKLSRY--DLMAGVTRAEAFF 582
            .:.....|.....|.....|:|             ||:..|   .||..|  ||...|.|.... 
  Fly   325 HKKDCLGSMPVIMGYNSAEGLA-------------IVVKAK---QKLEAYEDDLARLVPRNLVL- 372

  Fly   583 SFNSGDVQYGIEADRRSRILKAYVRNTYTFHLNEIFATIVNEYTDWERPVQHPINIRDETLEALS 647
                 |.| ..||...:..::|:..|........:                      |..::..|
  Fly   373 -----DPQ-APEAQEAASDIRAFFFNGQALSKENM----------------------DNLVDLFS 409

  Fly   648 DAQVVAPAAQTVDLHSADHRNS--YLYVFDY------QTRFGDYPQRQGCIHGEDLPYIFGAPLV 704
            |........:.|::|::....|  |.|..||      ..:.......:|..|.:|:.|:|  .:.
  Fly   410 DYHFSMDLQRAVEIHASCQTQSPLYFYRLDYVGGRNLYKKIFQNEDLRGVAHADDICYLF--QMA 472

  Fly   705 GGFNHFTRNYTKTEISLSEVVMFYWSNFVRTGNPN---EQMETEHGSRQERSRYKTIEWTAYESV 766
            |......|:    ::.::|.:...|:||.|.|.|:   :.::..|..               |.:
  Fly   473 GDETEMNRD----DLMVTERLCEMWANFARDGKPSPIWKPVKKPHNG---------------EPI 518

  Fly   767 HKKYLNFDTKPKLKNHYRAHRLSFWLNL 794
            ....|..|.:.|:.::....|:.||.::
  Fly   519 QLDCLLIDRELKMCSNPDGERMDFWRSM 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 151/673 (22%)
Aes <313..>410 CDD:223730 40/104 (38%)
cltNP_536784.1 COesterase 22..543 CDD:278561 151/673 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.