DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est1 and Nlg2

DIOPT Version :9

Sequence 1:NP_524269.3 Gene:alpha-Est1 / 40909 FlyBaseID:FBgn0015568 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster


Alignment Length:613 Identity:152/613 - (24%)
Similarity:239/613 - (38%) Gaps:142/613 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TKVVCTRDGQVRGHRRRTLYDEEMYFAFEGIPFAQPPVGELRFRAPQPPHPWLGVRDC------- 89
            :..|.|:.|.:||...|:   ..:..||.|||:|.||||.|||..|..|..|..||..       
  Fly   182 SNTVKTKYGLLRGIVVRS---SPLVEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSPVC 243

  Fly    90 ---------------TYPRAKPMQKHFVLSIVEG-SEDCLYLNVY----SKRLR------SDKP- 127
                           ..|||:..|...:|.:::. ||||||||:|    ::|.|      :.:| 
  Fly   244 PQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPK 308

  Fly   128 --LPVIVWIYGGGFQFGEAGRDFYSPDYFMQQDVVVVTFNYRVGALGFLSLADRDLDVPGNAGLK 190
              |..:|:|:|..:.: .:|..:...:.....:|:|||.|:|:|..|||....:: ...||.||.
  Fly   309 TKLSTVVFIHGESYDW-NSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKE-SAQGNFGLM 371

  Fly   191 DQVMALRWISQNIAQFNGDPQNITVMGESAGAASVHALMTTEQTRGLFHKAIMQSGSMFCEWANE 255
            |.|..|.|:.:|:..|.||||:||::|...||...:.|:.:.....|..:.::.|||....||.:
  Fly   372 DLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQRTVLVSGSALSPWAIQ 436

  Fly   256 PSGRWA-YRLACQLGYSGSENEKEVFRYLQKAPASEMAAQGITLVSQEERRQYVLFPFTPVVEPY 319
            .:..:. .|:|.|.|..|.....::...|:....:|:.|     |..:..|..|.|      .|:
  Fly   437 KNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVAELLA-----VKVDHPRFLVGF------APF 490

  Fly   320 ITRDCVLPRCHREMLPEAWGNDLPLILGGNSFEGLFSYQSTLHDEEHMLSAFEV---LIPREIRE 381
            :....:.|..:     ......|||.....|..|:........|....|::.|.   |..:::..
  Fly   491 VDGTVISPGAN-----PLGSTTLPLGSAIVSTSGIEYANFPKRDLIFCLTSVESYLDLSAQDLEF 550

  Fly   382 KSTQSHLKDLLRQFKVDNFDDATRGRMEFNECLHILSVKHFWHGIHRTVLARLSHAPATPTYLYR 446
            ...::....:||.|..:||      ....||...:|  |:.:....:.:...||...||..:|..
  Fly   551 GFNETRRDRILRTFVRNNF------HYHLNEIFAVL--KNEYTDWEKAIRNPLSSRDATLQFLSD 607

  Fly   447 FDVDSP---------------HFNHFRQVMCGKH-------------VRGVSHADD--------L 475
            ....||               :|.||      ||             |||    :|        :
  Fly   608 GHTASPLIKLGYMHSLRGGRAYFLHF------KHKTIEEEYPQRSGSVRG----EDVPFWLGLPM 662

  Fly   476 SYLFYHILANKVDKSSMEYQTIQRLVGMWVA-----FARNDNPN---CPQIGPTTWEALD----- 527
            |.||.|           .|.|.:|.:|..:.     ||:..|||   ...:.|...|.|:     
  Fly   663 SPLFPH-----------NYTTQERQIGRLMLRYLSNFAKTGNPNQSTAKSVLPNPNEVLETALHQ 716

  Fly   528 EKGPQMCL---NIGKQLEFIVLPESKQN 552
            :|.....|   |:.:.|...||...:::
  Fly   717 QKKRSTSLTHPNLSEALNLAVLYNQRRS 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est1NP_524269.3 COesterase 28..541 CDD:278561 149/600 (25%)
Aes <117..>233 CDD:223730 39/128 (30%)
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 146/579 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.