DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est1 and NLGN4Y

DIOPT Version :9

Sequence 1:NP_524269.3 Gene:alpha-Est1 / 40909 FlyBaseID:FBgn0015568 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001352513.1 Gene:NLGN4Y / 22829 HGNCID:15529 Length:836 Species:Homo sapiens


Alignment Length:608 Identity:157/608 - (25%)
Similarity:254/608 - (41%) Gaps:135/608 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QTKVVCTRDGQVRGHR----RRTLYDEEMYFAFEGIPFAQPPVGELRFRAPQPPHPWLGVRDCTY 91
            |..||.|..|:::|.|    ...|...|.|.   |:|:|.||.||.||:.|:.|..|.|:|:.|.
Human    44 QYPVVNTNYGKIQGLRTPLPSEILGPVEQYL---GVPYASPPTGERRFQPPESPSSWTGIRNATQ 105

  Fly    92 PRA---KPMQKHFVLS-----------------IVEGSEDCLYLNVY-----------------S 119
            ..|   :.:.:.|:|.                 :.:.:|||||||:|                 |
Human   106 FSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITS 170

  Fly   120 KRLRSDKPL-------PVIVWIYGGGFQFGEAGRDFYSPDYFMQQDVVVVTFNYRVGALGFLSLA 177
            .....||.:       ||:|:|:||.:..| .|............:|:|:|.|||:|.|||||..
Human   171 NDHGEDKDIHEQNSKKPVMVYIHGGSYMEG-TGNMIDGSILASYGNVIVITINYRLGILGFLSTG 234

  Fly   178 DRDLDVPGNAGLKDQVMALRWISQNIAQFNGDPQNITVMGESAGAASVHALMTTEQTRGLFHKAI 242
            |:  ...||.||.||:.|||||.:|:..|.|||:.:|:.|..|||:.|..|..:..:.|||.|||
Human   235 DQ--AAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAI 297

  Fly   243 MQSGSMFCEWA-NEPSGRWAYRLACQLGYSGSENEKEVFRYLQKAPASEMAAQGITLVSQEERRQ 306
            :|||:....|| |....::...||.::|.:..:. .::...|:.....|:..|.||..:..    
Human   298 IQSGTALSSWAVNYQPAKYTRILADKVGCNMLDT-TDMVECLKNKNYKELIQQTITPATYH---- 357

  Fly   307 YVLFPFTPVVEPYITRDCVLPRCHREMLPEAWGNDLPLILGGNSFEGLFSYQSTLHDEEHML-SA 370
               ..|.||::     ..|:|...:.::.:....:..::||.|..|||......:.:|:.:. :.
Human   358 ---IAFGPVID-----GDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPND 414

  Fly   371 FEVLIPREIREKSTQSHLKDLLRQ---FKVDNFDD----ATRGRMEFNECLHILSVKHFWHGIHR 428
            |:..:...:.........||.||:   |...::.|    .||     .:.|..|...|.|  :..
Human   415 FDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETR-----RKTLVALFTDHQW--VAP 472

  Fly   429 TVLARLSHAP-ATPTYLYRFDVDSPHFNHFRQVMCGKHVR----GVSHADDLSYLF-------YH 481
            .|.....||. .:|||.|.|      ::|     |...::    ..:|.|::.|:|       ..
Human   473 AVATADLHAQYGSPTYFYAF------YHH-----CQSEMKPSWADSAHGDEVPYVFGIPMIGPTE 526

  Fly   482 ILANKVDKSSMEYQTIQRLVGMWVAFARNDNPNCPQIGPTTWEALDEKGPQMCLNIGKQLEFIVL 546
            :.:....|:.:....:  ::..|..||:..:||.|                    :.:..:||  
Human   527 LFSCNFSKNDVMLSAV--VMTYWTNFAKTGDPNQP--------------------VPQDTKFI-- 567

  Fly   547 PESKQNRI----WDRLYDKNDLF 565
             .:|.||.    |.:...|:.|:
Human   568 -HTKPNRFEEVAWSKYNPKDQLY 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est1NP_524269.3 COesterase 28..541 CDD:278561 149/578 (26%)
Aes <117..>233 CDD:223730 48/139 (35%)
NLGN4YNP_001352513.1 COesterase 46..610 CDD:306613 156/606 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.