DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est1 and cest-7

DIOPT Version :9

Sequence 1:NP_524269.3 Gene:alpha-Est1 / 40909 FlyBaseID:FBgn0015568 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001257187.1 Gene:cest-7 / 182819 WormBaseID:WBGene00007693 Length:606 Species:Caenorhabditis elegans


Alignment Length:296 Identity:85/296 - (28%)
Similarity:141/296 - (47%) Gaps:37/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KLIGHKIVQYRLGTKQTKVVCTRDGQVRG---------HRRRTLYDEEMYFAFEGIPFAQPPVGE 71
            |:..:.:....|..|..||:.|..|:|||         |:          :.|:|||||:||:|.
 Worm    21 KIFFYTLALLALSVKSFKVLNTNYGKVRGITDFSDKRNHK----------YIFKGIPFAKPPLGL 75

  Fly    72 LRFRAPQPPHPWLGVRDCTYPRAKPMQKHFVLSIVEG--SEDCLYLNVYSKRLRSDKPLPVIVWI 134
            |||..|:.|:.|.||.|.:...|..:....:.|..:.  ||||||:|:::.........||:|:.
 Worm    76 LRFALPEEPNTWNGVLDGSKYSAACLSNSSLASAQQENISEDCLYINIFTSEYCLAHKCPVLVYY 140

  Fly   135 YGGGFQFGEAGR--DFYSPDYFMQQDVVVVTFNYRVGALGFLSLADRDLDVPGNAGLKDQVMALR 197
            :||.|....|..  |.:..:.::...:|.....||:|..|...|.::.: ||.|..:.|.:.:|.
 Worm   141 HGGSFNLDSATMFPDKFILERYVDSGIVFAIPAYRLGVFGQFYLGEQGI-VPANLLIHDCIRSLN 204

  Fly   198 WISQNIAQFNGDPQNITVMGESAGAASVHALMTTEQ---TRGLFHKAIMQSGSMFCEWANEPSGR 259
            ::..|||.|.|||..:|:||.|:|...|:|:..:.|   .:.||.:.|:.|......:.:...|.
 Worm   205 FVHDNIASFGGDPNYVTLMGHSSGGQLVNAMGFSNQIDPEKKLFQQFIVLSSIGMYGFEDLQIGN 269

  Fly   260 WAYRLA----CQLGYSGSENEKEVFRYLQKAPASEM 291
             :|.:|    |.     |||.:|:...::...|.::
 Worm   270 -SYEIARRHNCT-----SENSQEIVDCMRNIDALQL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est1NP_524269.3 COesterase 28..541 CDD:278561 83/284 (29%)
Aes <117..>233 CDD:223730 33/117 (28%)
cest-7NP_001257187.1 Abhydrolase 34..510 CDD:304388 83/283 (29%)
Aes <135..>236 CDD:223730 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.