DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est1 and cest-12

DIOPT Version :9

Sequence 1:NP_524269.3 Gene:alpha-Est1 / 40909 FlyBaseID:FBgn0015568 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_499576.4 Gene:cest-12 / 176642 WormBaseID:WBGene00013540 Length:850 Species:Caenorhabditis elegans


Alignment Length:228 Identity:86/228 - (37%)
Similarity:125/228 - (54%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VVCTRDGQVRGHRRRTLYDEEMYF-----AFEGIPFAQPPVGELRFRAPQPPHPW-LGVRDCTYP 92
            |.|:: |.|:|.:.....|:...:     ||.|||:.|.|||.||.:.|||.:.: ..:.|.||.
 Worm    37 VSCSQ-GSVQGRQVNLGNDQSQLYSGQANAFTGIPYCQAPVGNLRLQPPQPLNQFNTTLHDATYF 100

  Fly    93 RAKPMQKHFVLSIVEG--SEDCLYLNVYSKRL-RSDKPLPVIVWIYG-GGFQFG--EAGRDFYSP 151
            |.|..|.:     ..|  :|||||||||:.:. .::..|.|:|.|.| .||..|  :..::....
 Worm   101 RPKCPQLN-----AGGPTNEDCLYLNVYTPQAGNTNANLSVLVLIDGSNGFSNGGCDQNQEKGII 160

  Fly   152 DYFMQQDVVVVTFNYRVGALGFLSLADRDLDVPGNAGLKDQVMALRWISQNIAQFNGDPQNITVM 216
            ...:|:.:||||..||:|||||.:....  .|..|.|:.|||.|:|||...|..|.|:|..|||.
 Worm   161 SNLVQRQIVVVTMQYRIGALGFFTTYTN--SVQSNLGMLDQVQAMRWIKTEIVNFGGNPNQITVA 223

  Fly   217 GESAGAASVHALMTTEQTRGLFHKAIMQSGSMF 249
            |:..||.:|.|...:..::.||::||:||||::
 Worm   224 GQDDGACAVSAHCLSPMSQNLFNQAIVQSGSVY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est1NP_524269.3 COesterase 28..541 CDD:278561 86/228 (38%)
Aes <117..>233 CDD:223730 44/119 (37%)
cest-12NP_499576.4 Abhydrolase 37..>400 CDD:389770 86/228 (38%)
Abhydrolase <678..774 CDD:389770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.