DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and AT1G68620

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_564936.1 Gene:AT1G68620 / 843192 AraportID:AT1G68620 Length:336 Species:Arabidopsis thaliana


Alignment Length:107 Identity:34/107 - (31%)
Similarity:52/107 - (48%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SEKPLPVIVWIYGGGFQKGEASRDIYSPDYFM-----KKPVVFVAINYRLAALGFLSLKDPKLDV 183
            |...||:||:.:||||..|.||...|..  |:     :...:.:::|||||         |:..:
plant    85 SVSKLPLIVYFHGGGFCVGSASWLCYHE--FLARLSARSRCLVMSVNYRLA---------PENPL 138

  Fly   184 PGNAGLKDQVMALRWISQ----NIAHFNGDPNNITLMGESAG 221
            |  |..:|.|.|:.|:::    |:.....|...|.|.|:|||
plant   139 P--AAYEDGVNAILWLNKARNDNLWAKQCDFGRIFLAGDSAG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 34/107 (32%)
AT1G68620NP_564936.1 Abhydrolase_3 92..306 CDD:400284 31/100 (31%)

Return to query results.
Submit another query.