DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and GID1C

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_198084.1 Gene:GID1C / 832790 AraportID:AT5G27320 Length:344 Species:Arabidopsis thaliana


Alignment Length:106 Identity:30/106 - (28%)
Similarity:46/106 - (43%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LPVIVWIYGGGFQKGEASRDIYSPDYFMKKPV-----VFVAINYRLAALGFLSLKDPKLDVPGNA 187
            :||||:.:||.|....|:..||  |...::.|     |.|::|||.|         |:...|  .
plant   104 VPVIVFFHGGSFAHSSANSAIY--DTLCRRLVGLCGAVVVSVNYRRA---------PENRYP--C 155

  Fly   188 GLKDQVMALRWISQN--IAHFNGDPNNITLMGESAGSASVH 226
            ...|....|:|::.:  :.........|.|.|:|:|...||
plant   156 AYDDGWAVLKWVNSSSWLRSKKDSKVRIFLAGDSSGGNIVH 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 30/106 (28%)
GID1CNP_198084.1 Abhydrolase_3 107..320 CDD:400284 28/103 (27%)

Return to query results.
Submit another query.