DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and NLGN2

DIOPT Version :9

Sequence 1:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:615 Identity:182/615 - (29%)
Similarity:275/615 - (44%) Gaps:138/615 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILDTKYGQVRGLQRKTVYDKE---PYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTT---- 91
            :::|.||:|||::|:  .:.|   |...|.|:|||.||:|..||:.|:.|..|.||.|.||    
Human    43 VVNTAYGRVRGVRRE--LNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPA 105

  Fly    92 ---NRSKPMQRNML------------LGIVEGSEDCLHLNVYVKALKSEKPL------------- 128
               |....:...||            ..:...|||||:||:||..  .:.||             
Human   106 CPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPT--EDGPLTKKRDEATLNPPD 168

  Fly   129 ---------PVIVWIYGGGFQKGEASRDIYSPDYFMKKPVVFVA-INYRLAALGFLSLKDPKLDV 183
                     ||:::::||.:.:|  :.:::..........|.|| :||||..|||||..|..  .
Human   169 TDIRDPGKKPVMLFLHGGSYMEG--TGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQA--A 229

  Fly   184 PGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHVMMTTEQTRGLFHKAIMQSGCA 248
            .||.||.||:.||||:|:|||||.|||..||:.|..||::.|::::.:..:.|||.|||.|||.|
Human   230 KGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTA 294

  Fly   249 LSEW-VESPDNNWAFRLAQNLGYKGDEKD-ADVLSFLSKVCARQIAAIDQDVINLDEVRSFLLFA 311
            :|.| |......:...||..:|.  |.:| |:.:..|.:..:|::  :||||   ...|..:  |
Human   295 ISSWSVNYQPLKYTRLLAAKVGC--DREDSAEAVECLRRKPSREL--VDQDV---QPARYHI--A 350

  Fly   312 FGPVIEPYETDHCVVPKRHKDLLSEAWGNDIPVIVGGNSFEGL-FSYQLVRKD--------PWAL 367
            ||||:     |..|||...:.|:.:....:..:::|.|..||| |.......:        .:.:
Human   351 FGPVV-----DGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTV 410

  Fly   368 KNFHNIL---PREVRETSSLEGQDLLVRRLKQLYF------NNEMQESMEMFEALNIFSHRQIWH 423
            .||.:.|   |         ||:|:|...:|.:|.      |.||:..    ..|.:|:..| | 
Human   411 SNFVDNLYGYP---------EGKDVLRETIKFMYTDWADRDNGEMRRK----TLLALFTDHQ-W- 460

  Fly   424 DTHRFILARQSYAPKTPTYLYRFDFDSP-HFNQFRRLVCGDRIR----GVAHADELSYLF----- 478
                       .||...|.....|:.|| :|..|.. .|....|    ..||.|||.|:|     
Human   461 -----------VAPAVATAKLHADYQSPVYFYTFYH-HCQAEGRPEWADAAHGDELPYVFGVPMV 513

  Fly   479 --YNIIASKLDKSSMEYKTIERMVGMWTSFASSGNPNCPELGSAKW---------EAVQLKENAV 532
              .::......|:.:....:  ::..||:||.:|:||.|.....|:         |.|..|.|:.
Human   514 GATDLFPCNFSKNDVMLSAV--VMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSK 576

  Fly   533 EKCF-NISHDLEMRDLPESDCLAVWDTFYP 561
            ||.: :|.....:||...::.:|.|....|
Human   577 EKQYLHIGLKPRVRDNYRANKVAFWLELVP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 170/574 (30%)
Aes <117..>221 CDD:223730 44/126 (35%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 180/608 (30%)
Aes <170..>268 CDD:223730 41/101 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.