DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and Aadac

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_065413.1 Gene:Aadac / 57300 RGDID:631440 Length:398 Species:Rattus norvegicus


Alignment Length:226 Identity:47/226 - (20%)
Similarity:78/226 - (34%) Gaps:87/226 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIKMGAQLVGHKVQQYRLSTGHTVILDTKYGQVRGLQR--KTVYDKEPYFAFEGIPYAKPPVGDL 72
            |:|:|..|                   ..:|::.||..  .||   :.:..|:.:    ||..| 
  Rat    38 LLKLGGDL-------------------ASFGELLGLNHFMDTV---QLFMRFQVV----PPTSD- 75

  Fly    73 RFRAPQPPEPWQGVLNCTTNRSKPMQRNMLLGIVEGSEDCLHLNVYVKALKSEKPLPVIVWIYGG 137
                          .|.|              ::|...:.:.:.:|:...||......:.:|:||
  Rat    76 --------------ENVT--------------VMETDFNSVPVRIYIPKRKSTTLRRGLFFIHGG 112

  Fly   138 GFQKGEASRDIYSPDYFM----------KKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQ 192
            |:..|.|:       |||          :...|.|:.:|.||         ||...|..  .:|.
  Rat   113 GWCLGSAA-------YFMYDTLSRRTAHRLDAVVVSTDYGLA---------PKYHFPKQ--FEDV 159

  Fly   193 VMALRWISQN--IAHFNGDPNNITLMGESAG 221
            ..:|||..|.  :..:..||..:.:.|:|||
  Rat   160 YHSLRWFLQEDILEKYGVDPRRVGVSGDSAG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 43/202 (21%)
AadacNP_065413.1 Abhydrolase_3 106..373 CDD:400284 28/103 (27%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 110..112 0/1 (0%)

Return to query results.
Submit another query.