DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:308 Identity:67/308 - (21%)
Similarity:101/308 - (32%) Gaps:139/308 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LKSEKPLPVIVWIYGGGFQKGEASRDIY----------------SPDYFMKKPVVFVAINYRLAA 170
            |..|.|:||:|::|||.:  |...|.||                .|||.:.              
Zfish   112 LSDESPVPVVVFVYGGAW--GSGDRSIYCLLALQMAKELNASVICPDYSIY-------------- 160

  Fly   171 LGFLSLKDPKLDVPGNA--GLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHVMMTTEQ 233
                    ||    ||.  .::|...:|.|:.|....|:.|.:||.|:|.|||:   |:      
Zfish   161 --------PK----GNVLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAGA---HL------ 204

  Fly   234 TRGLFHKAIMQSGCALSEWVESPDNNWAFRLAQNLG--YKGDEKDADVLSFLSKVCARQIAAIDQ 296
                         |||:          :..||.|:.  :....|..|:::.:..:..........
Zfish   205 -------------CALT----------SLFLASNVEELFIETNKQKDLVTAIKGIIGLSGVYSIM 246

  Fly   297 DVINLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWGNDIPVIVGGNSFEGL--FSY-- 357
            |..|.::||:         :|...|.|                         .:.:|:  |.|  
Zfish   247 DHYNHEKVRA---------VEYVSTMH-------------------------KAMDGVENFDYYS 277

  Fly   358 -----------QLVRKDPWALKNFHN----ILPREVRETSSLEGQDLL 390
                       ||.|..|.||  ||.    |:|.|    ||:...:||
Zfish   278 PTSLLKKMKEDQLKRVPPMAL--FHGTNDIIVPVE----SSVRFSELL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 67/308 (22%)
Aes <117..>221 CDD:223730 31/116 (27%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 67/308 (22%)
Abhydrolase 121..>210 CDD:304388 32/148 (22%)
Abhydrolase 167..336 CDD:304388 47/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.