DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and Aadacl4fm1

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_941064.2 Gene:Aadacl4fm1 / 381572 MGIID:2685880 Length:407 Species:Mus musculus


Alignment Length:219 Identity:44/219 - (20%)
Similarity:74/219 - (33%) Gaps:93/219 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VYVKALK--------------SEKPLPVIVWIYGGGFQKG--EASRDIYSPDYFMKKPV--VFVA 163
            |:||.|:              |.||...|::.:|||...|  ::..::.:   |:.:..  |.|:
Mouse    87 VFVKDLRFGTIPVRLFRPKAASSKPRRGILFFHGGGAMIGSLDSHHNLCT---FLARETDSVLVS 148

  Fly   164 INYRLAALGFLSLKDPKLDVPGNAGL-KDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHV 227
            :.||            ||....:..| .|.:.|.....:::..:..||:.:.:.|||.|.|:..|
Mouse   149 VGYR------------KLPYYHHPSLYHDCINASIHFLKSLKAYGIDPSRVVICGESIGGAAAVV 201

  Fly   228 MMTTEQTR-------------------------GLFHKAI------------------------- 242
            :..|..:|                         .|.||.|                         
Mouse   202 VTQTLLSRTDIPKIRAQVLIYPILQAFYFQSPSHLMHKNIPFLTKDFMITCICKYLAIDFSWKDA 266

  Fly   243 MQSGCALS--------EWVESPDN 258
            |.:|..:|        :|: ||||
Mouse   267 MLTGACISPSAWKKYEKWL-SPDN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 44/219 (20%)
Aadacl4fm1NP_941064.2 alpha/beta hydrolases 115..380 CDD:473884 37/191 (19%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 0/1 (0%)

Return to query results.
Submit another query.