DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and AADACL2

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_997248.2 Gene:AADACL2 / 344752 HGNCID:24427 Length:401 Species:Homo sapiens


Alignment Length:139 Identity:32/139 - (23%)
Similarity:63/139 - (45%) Gaps:23/139 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LNVYVKALKSEKPLPVIVWIYGGGFQKGEASRDIYSPDYFMKK------PVVFVAINYRLAALGF 173
            :.:|:...|||.....:::.:||||..|.:.:..:.   |:.:      ..|.|.::||||    
Human    91 VRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAFD---FLNRWTANTLDAVVVGVDYRLA---- 148

  Fly   174 LSLKDPKLDVPGNAGLKDQVMALRW--ISQNIAHFNGDPNNITLMGESA-GSASVHVMMTTEQTR 235
                 |:...|  |..:|.:.|:::  :.:.:..:..||..|.:.|:|: |:.:..|....:...
Human   149 -----PQHHFP--AQFEDGLAAVKFFLLEKILTKYGVDPTRICIAGDSSGGNLATAVTQQVQNDA 206

  Fly   236 GLFHKAIMQ 244
            .:.||..||
Human   207 EIKHKIKMQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 32/139 (23%)
AADACL2NP_997248.2 Abhydrolase_3 107..372 CDD:400284 28/123 (23%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 111..113 0/1 (0%)

Return to query results.
Submit another query.