DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and Glt

DIOPT Version :9

Sequence 1:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster


Alignment Length:531 Identity:151/531 - (28%)
Similarity:241/531 - (45%) Gaps:86/531 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VILDTKYGQVRGLQ-RKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSK- 95
            |:...:.||:.|:. .||:.:: |..||.||.|.....|..||:|.| |..:||.:|.|..... 
  Fly    61 VVQAPEVGQILGISGHKTIANR-PVNAFLGIRYGTVGGGLARFQAAQ-PIGYQGRVNATVQSPNC 123

  Fly    96 ---PMQRNMLLGIVEGS--EDCLHLNVYVKALKSEKPLPVIVWIYG-----GGFQKGEASRDIYS 150
               |....:.|....|.  :|||.|::|  |.:....|||:|:::|     ||.::.:       
  Fly   124 AQFPELDRLRLSESRGENVDDCLTLDIY--APEGANQLPVLVFVHGEMLFDGGSEEAQ------- 179

  Fly   151 PDYFMKKPVVFVAINYRLAALGFLS-LKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNIT 214
            |||.::|.|:.|:||||||..|||| |.|   ::|||..|.|..:||.|:.:|:.||.|:...:|
  Fly   180 PDYVLEKDVLLVSINYRLAPFGFLSALTD---ELPGNVALSDLQLALEWLQRNVVHFGGNAGQVT 241

  Fly   215 LMGESAGSASVHVMMTTEQTRGLFHKAIMQSGCALSEWV---ESPDNNWAF-RLAQ------NLG 269
            |:|::.|:...|.:..:.:...||.:.|:|||.||:.::   :..|....| |||:      |..
  Fly   242 LVGQAGGATLAHALSLSGRAGNLFQQLILQSGTALNPYLIDNQPLDTLSTFARLARCPPPSINPS 306

  Fly   270 YKGDEKDADVLSFLSKVCARQIAAIDQ-----DVINLDEVRSFLLFAFGPVIEPYETDHCVVPKR 329
            .:|.:...|.|:.|.  .::.:||.:|     :.:.|.::..|.|....|:        ..:|. 
  Fly   307 AQGLKPLYDCLARLP--TSQLVAAFEQLLLQNEHLGLTQLGGFKLVVGDPL--------GFLPS- 360

  Fly   330 HKDLLSEAWGNDIPVIVGGNSFEGLFSY-----QLVRKDPWALKNFHNILPREVRETSSLEGQDL 389
            |...|:......:|:|:|.......|..     ||.|.....:.::.:::.|.....|.      
  Fly   361 HPASLATNSSLALPMIIGATKDASAFIVSRIYDQLARLQSRNVSDYIDVVLRHTAPPSE------ 419

  Fly   390 LVRRL-KQLYFNNEMQESMEMFEALNIFSHRQIWHDTHRFILAR--------QSYAPKTPTYLYR 445
              .|| ||...........|...:|...:...:  :...:||.|        |||. ..|.|||.
  Fly   420 --HRLWKQWALREIFTPIQEQTASLQTVAPGLL--ELSNYILYRAPVINSISQSYR-SVPAYLYT 479

  Fly   446 FDFDSPHFNQFRRLVCGDRIRGV--AHADELSYLF-YNIIASKLDKSSMEYKTIERMVGMWTSFA 507
            ||:...| ::|..| ......||  :.:|:..||| |...||:|  :.::......:|.||.:||
  Fly   480 FDYRGEH-HRFGHL-SNPLPFGVDASLSDDSVYLFPYPPEASRL--NPLDRSLSRALVTMWVNFA 540

  Fly   508 SSGNPNCPELG 518
            ::|.|| |..|
  Fly   541 TTGVPN-PSSG 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 151/531 (28%)
Aes <117..>221 CDD:223730 42/109 (39%)
GltNP_001245946.1 COesterase 55..579 CDD:278561 151/531 (28%)
Aes <146..345 CDD:223730 68/212 (32%)
RILP-like <677..>717 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.