DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and cel.1

DIOPT Version :9

Sequence 1:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_955901.2 Gene:cel.1 / 322481 ZFINID:ZDB-GENE-030131-1201 Length:550 Species:Danio rerio


Alignment Length:519 Identity:156/519 - (30%)
Similarity:230/519 - (44%) Gaps:93/519 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKYGQVRGLQRKTVYDKEPYF-AFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQRN 100
            |:.|.|:|..|.....:  |. .|:|||:|.||   .||..|.....|:|||..|..|.:.:|.|
Zfish    27 TEGGMVQGKSRSVGLFR--YMDTFKGIPFAAPP---KRFEKPVAHPGWEGVLKTTDYRKRCLQLN 86

  Fly   101 MLLGIVEGSEDCLHLNVYV---KALKSEKPLPVIVWIYGGGFQKGEASRDIYSPDYFM------- 155
            :|...|.||||||:||::|   :.:.|.  |||:|:||||.|..|......:..:|..       
Zfish    87 LLATDVIGSEDCLYLNIWVPQGRTVSSN--LPVMVFIYGGAFLLGGGQGANFLDNYLYDGEEMAD 149

  Fly   156 KKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESA 220
            :..|:.|..|||:.||||:|..|.  .:|||.||.||..|:.|:.:||..|.|:|:||||.||||
Zfish   150 RGNVIVVTFNYRVGALGFMSTGDD--GIPGNYGLWDQHAAISWVHRNIKAFGGNPDNITLFGESA 212

  Fly   221 GSASVHVMMTTEQTRGLFHKAIMQSGCALSEWVESPD-NNWAFRLAQNLGYKGDEKDADVL---- 280
            |:|||:..:.|.:.:|:..:||.|||.||..|..|.: ..:|..:|..:|...|...||.|    
Zfish   213 GAASVNFQIITPKNKGMIRRAISQSGVALCPWAISRNPRQFAEEIATKVGCPIDSGMADCLKRAD 277

  Fly   281 ----SFLSKVCARQIAAIDQDVI-NLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWGN 340
                :...|:  :..::.|..:: ||         ...|||     |...:|...:.|...|  .
Zfish   278 PKAVTLAGKL--KLTSSPDAPIVHNL---------YLSPVI-----DGDFIPDEPETLFGNA--A 324

  Fly   341 DIPVIVGGNSFEGLFSYQLVRKDPWALKNFHNILPREVRETSSL-------EGQDLLVRRLKQLY 398
            ||..|.|.|..:   ::.....|..::.|.....|  |.|..:|       .|||..:...::..
Zfish   325 DIDYIAGVNDMD---AHIFATIDIPSINNALTTTP--VEEVQALATALSRDRGQDAGIATFQEYT 384

  Fly   399 FN-----NEMQESMEMFEALNIFSHRQIWHDTHRFILARQS-------YAPKTPTYLYRFDFDS- 450
            .|     |:.:....:.|.          ...:.|::..|:       .|....|:.|.|...| 
Zfish   385 VNWGDKPNKEKVKQTVVEL----------ETDYMFLVPTQAALYLHTDNAKSARTFSYLFTESSR 439

  Fly   451 -PHFNQFRRLVCGDRIRGVAHADELSYLFYNIIASKLDKSSMEYKTIERMVGMWTSFASSGNPN 513
             |.|..:         .|..|||||.|:|....|:.|..........:.|:..|::||.:|:||
Zfish   440 IPVFPLW---------MGADHADELQYVFGKPFATPLGYFPRHRDVSKYMIAYWSNFAQTGDPN 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 156/519 (30%)
Aes <117..>221 CDD:223730 45/113 (40%)
cel.1NP_955901.2 COesterase 25..517 CDD:306613 156/519 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575559
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.