DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and Nceh1

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_848887.1 Gene:Nceh1 / 320024 MGIID:2443191 Length:408 Species:Mus musculus


Alignment Length:107 Identity:19/107 - (17%)
Similarity:42/107 - (39%) Gaps:19/107 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSYDKTRFDVLSHLTDIPMLG---KQYVPGL--WKQFEDGHVTSRHEQSTEHRVGQESISQRNIT 61
            |.:.:.||...|...|:.::.   .|....|  |.|.:..::.....|...:.:         :.
Mouse   334 NEFVQMRFPKYSLPKDVQIVSTDENQVFLALQEWYQTDTYNLYQSDPQGVYYSI---------VL 389

  Fly    62 ETSPSTQRTRMNATLE-----NERGLTRSTEKVDSEFLILVS 98
            |...||::...|..::     ..:|:..:.:|||.:.:.|::
Mouse   390 ENVRSTKQPEENVLIDILEVRGVKGVFLANQKVDGKVMTLIT 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 10/70 (14%)
Nceh1NP_848887.1 Abhydrolase_3 109..381 CDD:400284 9/46 (20%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 113..115
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.