DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and Nceh1

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001120996.1 Gene:Nceh1 / 294930 RGDID:1311104 Length:408 Species:Rattus norvegicus


Alignment Length:203 Identity:43/203 - (21%)
Similarity:74/203 - (36%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQRNML--LG-------------- 104
            |:.:..:|.|   |.|          ||:.:|...|.|......|::  ||              
  Rat    17 YYVYIPLPSA---VSD----------PWKLMLLDATFRGAQQVSNLIHSLGLSHHLITLNFIIIS 68

  Fly   105 -------------IVEGSEDCLHLNVYVKALKSEKPL-PVIVWIYGGGFQKGEASRDIYSPDYFM 155
                         :.:...|.:.:.|:....|.::|| ..:|:|:|||:....|....|  |...
  Rat    69 FGKKSARSSPRVKVTDTDFDGVEVRVFEGPPKPDEPLRRSVVYIHGGGWALASAKISYY--DQLC 131

  Fly   156 -----KKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQN--IAHFNGDPNNI 213
                 :...|.|:|.|||.         |::..|..  :.|.:.|.::..|.  :..:..||..:
  Rat   132 TAMAEELNAVIVSIEYRLV---------PQVYFPEQ--IHDVIRATKYFLQPEVLDKYKVDPGRV 185

  Fly   214 TLMGESAG 221
            .:.|:|||
  Rat   186 GVSGDSAG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 43/203 (21%)
Nceh1NP_001120996.1 Abhydrolase_3 109..381 CDD:400284 25/98 (26%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 113..115 0/1 (0%)

Return to query results.
Submit another query.