DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and Aadacl3

DIOPT Version :10

Sequence 1:NP_524268.3 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001078972.1 Gene:Aadacl3 / 230883 MGIID:2685281 Length:408 Species:Mus musculus


Alignment Length:162 Identity:38/162 - (23%)
Similarity:64/162 - (39%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 KPMQRNMLLGIVEGSEDCLHL-NVYVKALKSEKPLPV----IVWIYGGGFQKG----------EA 144
            ||::|:..:.:.:     ||. .:.||..|.:||..:    |::.:|||...|          ..
Mouse    80 KPLKRDPDVVVKD-----LHFGTIPVKLYKPKKPSSIPRLGIIFFHGGGTIIGSLRTHNSICLRL 139

  Fly   145 SRDIYSPDYFMKKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQ-VMALRWISQNIAHFNG 208
            |::..|         |.|::.||         |.|....|   .:||. |:|.....:::..:..
Mouse   140 SKECDS---------VVVSVGYR---------KSPMYKYP---VMKDDCVVATTHFLESLDVYGV 183

  Fly   209 DPNNITLMGESAGSASVHVMMTTEQTRGLFHK 240
            ||..:...|:|.|..:..|   |.|.  |.|:
Mouse   184 DPARVVTCGDSVGGTAATV---TSQM--LVHR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_524268.3 COesterase 34..556 CDD:395084 38/162 (23%)
Aadacl3NP_001078972.1 Abhydrolase_3 116..379 CDD:400284 28/121 (23%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 120..122 0/1 (0%)

Return to query results.
Submit another query.