DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est2 and LOC107987423

DIOPT Version :9

Sequence 1:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_016885725.1 Gene:LOC107987423 / 107987423 -ID:- Length:286 Species:Homo sapiens


Alignment Length:278 Identity:63/278 - (22%)
Similarity:111/278 - (39%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 GPVIEPYETDHCVVPKRHKDLLSEAWGNDIPVIVGGNSFE-------GLFSY-----QLVRKDPW 365
            |.||     |..::.|..::|.:|...:.:|.:||.|..|       .|.||     ||.:|...
Human    39 GTVI-----DGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIPMQLMSYPLSEGQLDQKTAM 98

  Fly   366 AL--KNF------HNILPREVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMFEALNIFSHRQIW 422
            :|  |::      ..::|....:  .|.|.|..|:: |.|:              |::.:  .:.
Human    99 SLLWKSYPLVCIAKELIPEATEK--YLGGTDDTVKK-KDLF--------------LDLIA--DVM 144

  Fly   423 HDTHRFILARQSYAPKTPTYLYRFDFDSPHFNQFR--RLVCGDRIRGVAHADELSYLFYNIIAS- 484
            ......|:||.......|||:|.|.: .|.|:...  :.|.||      |.|||    :::..: 
Human   145 FGVPSVIVARNHRDAGAPTYMYEFQY-RPSFSSDMKPKTVIGD------HGDEL----FSVFGAP 198

  Fly   485 --KLDKSSMEYKTIERMVGMWTSFASSGNPNCPELGSAKWEAVQLKENAVEKCFNISHDLEMRDL 547
              |...|..|.:..:.::..|.:||.:||||..  |...|.....||..::...|.....:::|.
Human   199 FLKEGASEEEIRLSKMVMKFWANFARNGNPNGE--GLPHWPEYNQKEGYLQIGANTQAAQKLKDK 261

  Fly   548 PESDCLAVWDTFYPRESL 565
            .    :|.|...:.::::
Human   262 E----VAFWTNLFAKKAV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 56/234 (24%)
Aes <117..>221 CDD:223730
LOC107987423XP_016885725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.