DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est3 and GID1A

DIOPT Version :10

Sequence 1:NP_524267.2 Gene:alpha-Est3 / 40907 FlyBaseID:FBgn0015571 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_187163.1 Gene:GID1A / 819674 AraportID:AT3G05120 Length:345 Species:Arabidopsis thaliana


Alignment Length:155 Identity:39/155 - (25%)
Similarity:60/155 - (38%) Gaps:36/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LYLNVYAKE------LDSPRP-----LPLIVFFFGGGFEKGDPTKELHSPDYFMMRDV-----VV 131
            :|...||.:      ||..:|     :|:|:||.||.|........::  |....|.|     ||
plant    80 VYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIY--DTLCRRLVGLCKCVV 142

  Fly   132 VTVSYRVGPLGFLSLNDPAVGVPGNAGLKDQLLAMEWIKENAERFNGDPKNVTAF--GESAGAAS 194
            |:|:||..|..           |......|..:|:.|:...:...:.....|..|  |:|:|...
plant   143 VSVNYRRAPEN-----------PYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNI 196

  Fly   195 VHYLMLNPKAEGLFHKAILQSGNVL 219
            .|.:.|.....|:   .:|  ||:|
plant   197 AHNVALRAGESGI---DVL--GNIL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est3NP_524267.2 alpha/beta hydrolases 2..535 CDD:473884 39/155 (25%)
GID1ANP_187163.1 Abhydrolase_3 109..322 CDD:400284 32/126 (25%)

Return to query results.
Submit another query.