DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est4 and Ces1e

DIOPT Version :9

Sequence 1:NP_524266.1 Gene:alpha-Est4 / 40906 FlyBaseID:FBgn0015572 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_113753.2 Gene:Ces1e / 29225 RGDID:621508 Length:561 Species:Rattus norvegicus


Alignment Length:547 Identity:163/547 - (29%)
Similarity:239/547 - (43%) Gaps:114/547 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PVVQTTHGKVRG--ILLKSLYDEQFYAFDGIPYAVPPLGTLRFKEPHDLKPWHGIRD-------C 65
            |||.|..|||.|  :.|:. :.:....|.|:|:|.||||:|||..|...:||..:::       |
  Rat    24 PVVDTLQGKVLGKYVSLEG-FTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMC 87

  Fly    66 SK-PLSKCLQVSTLTKEVEG-----SEDCLYLNI--SVKTLNGDPMPVMVYIHGGAFKGGDSSRR 122
            |: |::..:....||...|.     |||||||||  .......|.:||||:||||....|.:|..
  Rat    88 SQDPVAGQIVNDLLTNREENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGASTY 152

  Fly   123 AWGPDYFMKENVVYISIGHRLGPLGFLSLNDPDLEVPGNAGLKDVILALRWIRANAANFNGDPER 187
            . |......||||.:.|.:|||..||.|..|....  ||.|..|.:.||.|::.|..||.|||..
  Rat   153 D-GLALSTHENVVVVVIQYRLGIWGFFSTGDEHSR--GNWGHLDQVAALHWVQDNIDNFGGDPGS 214

  Fly   188 ITIFGHSSGSMTVQLLLASPQSEGLFHRAILLAGFSM-----ELNRLPQMEYRLAKHLGYEG--- 244
            :||||.|:|..:|.:|:.||.::.|||:||..:|.::     :.|..|..| ::|...|.:.   
  Rat   215 VTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVALTAGLVKKNTRPLAE-KIAVVSGCKSTTS 278

  Fly   245 --------DNVDSQVLEFLLKADPALIVSADFFTPLEKRQGHNMPFKPSIESYSTPNAVLLAEPI 301
                    ...:.::||..||.:   :.|.|...  :.||.:  ||.|::    ....||...|.
  Rat   279 AAMVHCLRQKTEEELLETTLKLN---LFSLDLHG--DSRQSY--PFVPTV----LDGVVLPKMPE 332

  Fly   302 DLQRTTWSNRIPIILGANSGEGMSIF--------SFVKMNP----SWLKE--FQCN-PERVLPWT 351
            ::......|.:|.|:|.|..|...|.        |.:|::|    |.||:  |..| ||..:|..
  Rat   333 EILAEKDFNTVPYIVGINKQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVA 397

  Fly   352 ----LRNRCDPGQRRQLGQALIHHFCEAHGHELTVDHTNGLVELFTHGFVHAMDRLIQSRLTYGQ 412
                ||:..||.:.:                       :.|:||. ...:..:..:|.||   |.
  Rat   398 VEKYLRHTDDPDRNK-----------------------DQLLELI-GDVIFGVPSVIVSR---GH 435

  Fly   413 ----APTYLYRFDFDSPDFNFYRIRFMGKEQRG--VG-HVDELGYIFKLPATFKLDKSRPEFTAI 470
                |.||:|.|.        ||..|..|.:..  || |.||:..:|..| ..:...|:.|....
  Rat   436 RDAGARTYMYEFQ--------YRPSFSSKMKPSTVVGDHGDEIYSVFGAP-ILRGGTSKEEINLS 491

  Fly   471 RRLVAMFVQFAATSDPNAPLTKSLVDW 497
            :.::..:..||...:||.   :.|..|
  Rat   492 KMMMKFWANFARNGNPNG---QGLPHW 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est4NP_524266.1 Abhydrolase 7..529 CDD:304388 163/547 (30%)
Aes <104..>219 CDD:223730 51/114 (45%)
Ces1eNP_113753.2 COesterase 24..545 CDD:278561 163/547 (30%)
Aes 43..>239 CDD:223730 76/198 (38%)
Prevents secretion from ER (Potential) 558..561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.