DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est4 and cest-7

DIOPT Version :9

Sequence 1:NP_524266.1 Gene:alpha-Est4 / 40906 FlyBaseID:FBgn0015572 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001257187.1 Gene:cest-7 / 182819 WormBaseID:WBGene00007693 Length:606 Species:Caenorhabditis elegans


Alignment Length:365 Identity:106/365 - (29%)
Similarity:159/365 - (43%) Gaps:63/365 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVQTTHGKVRGILLKSLYDEQFYAFDGIPYAVPPLGTLRFKEPHDLKPWHGIRDCSKPLSKCLQV 75
            |:.|.:||||||...|......|.|.|||:|.||||.|||..|.:...|:|:.|.||..:.||..
 Worm    39 VLNTNYGKVRGITDFSDKRNHKYIFKGIPFAKPPLGLLRFALPEEPNTWNGVLDGSKYSAACLSN 103

  Fly    76 STL--TKEVEGSEDCLYLNI-SVKTLNGDPMPVMVYIHGGAFKGGDSSRRAWGPDYFMKE----- 132
            |:|  .::...||||||:|| :.:.......||:||.|||:| ..||:  ...||.|:.|     
 Worm   104 SSLASAQQENISEDCLYINIFTSEYCLAHKCPVLVYYHGGSF-NLDSA--TMFPDKFILERYVDS 165

  Fly   133 NVVYISIGHRLGPLGFLSLNDPDLEVPGNAGLKDVILALRWIRANAANFNGDPERITIFGHSSGS 197
            .:|:....:|||..|...|.:..: ||.|..:.|.|.:|.::..|.|:|.|||..:|:.|||||.
 Worm   166 GIVFAIPAYRLGVFGQFYLGEQGI-VPANLLIHDCIRSLNFVHDNIASFGGDPNYVTLMGHSSGG 229

  Fly   198 MTVQLLLASPQ---SEGLFHRAILLAGFSM------ELNRLPQMEYRLAKHLGYEGDN------- 246
            ..|..:..|.|   .:.||.:.|:|:...|      ::..    .|.:|:......:|       
 Worm   230 QLVNAMGFSNQIDPEKKLFQQFIVLSSIGMYGFEDLQIGN----SYEIARRHNCTSENSQEIVDC 290

  Fly   247 ------------------VDSQVLEFLLKADPALIVSADFFTPLEKRQGHNM----------PFK 283
                              ||....:.:::|.|.:.|........|.....||          .||
 Worm   291 MRNIDALQLLQTQTVMDDVDLLFFKAIIRAPPLMDVKQKLSEFKENVTARNMLCGVTDNEFTIFK 355

  Fly   284 PSIESYSTPNAVLLAEPID---LQRTTWSNRIPIILGANS 320
            .....|.:...:....|:|   :.|..::|..|..:.::|
 Worm   356 YPDGYYISATFLDFENPVDTVNVYRNKFTNITPTFVNSDS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est4NP_524266.1 Abhydrolase 7..529 CDD:304388 106/365 (29%)
Aes <104..>219 CDD:223730 44/122 (36%)
cest-7NP_001257187.1 Abhydrolase 34..510 CDD:304388 106/365 (29%)
Aes <135..>236 CDD:223730 39/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.