DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est4 and cest-9.1

DIOPT Version :9

Sequence 1:NP_524266.1 Gene:alpha-Est4 / 40906 FlyBaseID:FBgn0015572 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001359584.1 Gene:cest-9.1 / 181383 WormBaseID:WBGene00007692 Length:614 Species:Caenorhabditis elegans


Alignment Length:262 Identity:91/262 - (34%)
Similarity:134/262 - (51%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVQTTHGKVRGILLKSLYDEQFYAFDGIPYAVPPLGTLRFKEPHDLKPWHGIRDCSKPLSKCL-- 73
            |:||::||:|||.:.|......|.|..:|:|.||:|.|||.:|.:.:.|.||.|.||....|:  
 Worm    20 VIQTSYGKLRGITVWSNDKNHRYMFKSVPFAKPPVGNLRFAKPQNPESWSGILDASKYSPACMSN 84

  Fly    74 QVSTLTKEVEGSEDCLYLNI--SVKTLNGDPMPVMVYIHGGAFKGGDSS---RRAWGPDYFMKEN 133
            ..||.|.:...||||||:||  |.|.|| ...||:||.||||: ..||:   ...:..|.:..|:
 Worm    85 SSSTSTPQKHYSEDCLYINIFTSEKCLN-SKCPVIVYFHGGAY-NLDSAIMFNDTFILDRYAAED 147

  Fly   134 VVYISIGHRLGPLGFLSLNDPDLEVPGNAGLKDVILALRWIRANAANFNGDPERITIFGHSSGSM 198
            ||::....|||..|.|.....|| :..|..|.|.:.||.::.:....|.||.:|:|..|||||..
 Worm   148 VVFVIPAVRLGVFGQLYFGPSDL-LSENLFLYDAVQALSFVHSEINYFGGDSKRVTAMGHSSGGT 211

  Fly   199 TVQLL----LASPQSEGLFHRAILLAG------FSMELNRLPQMEYRLAKHLGYEGDNVDSQVLE 253
            .|..|    |..|..: ||.:.|:|:.      :.|.::....:..:...:.|.:.|..::.:.|
 Worm   212 IVDALGFSKLIDPGVK-LFQQMIVLSATGMFGFYDMVVDNSFAIVEKFGCYNGTKDDRPNANIAE 275

  Fly   254 FL 255
            .|
 Worm   276 ML 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est4NP_524266.1 Abhydrolase 7..529 CDD:304388 91/262 (35%)
Aes <104..>219 CDD:223730 43/121 (36%)
cest-9.1NP_001359584.1 Abhydrolase 19..498 CDD:389770 91/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.